BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10g19 (676 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1398 - 26271034-26271131,26271314-26271425,26271750-262717... 30 1.5 03_06_0722 - 35751490-35754357 30 1.5 02_03_0146 + 15720790-15721194,15721350-15721446,15721663-157219... 30 1.9 02_02_0238 + 8163922-8164362,8165008-8165118,8165205-8165249,816... 30 1.9 08_01_0329 - 2962018-2962695 29 2.6 05_05_0348 + 24271764-24271898,24273055-24273144,24273205-242733... 29 3.4 11_06_0607 + 25437897-25438046,25438180-25438236,25438522-254386... 28 5.9 11_01_0635 - 5091381-5091562,5092800-5092866,5093079-5093960 28 5.9 04_04_1365 - 32967604-32968367,32969097-32969221,32969583-32969632 28 5.9 03_05_0354 + 23411485-23411802,23411886-23412176,23414610-234146... 28 5.9 02_01_0369 + 2649178-2655291,2655773-2656601,2656737-2657425,265... 28 5.9 04_04_0076 + 22558105-22558261,22558356-22558405,22559837-225600... 28 7.8 02_04_0448 - 23001579-23001683,23001783-23002382,23002479-230026... 28 7.8 01_07_0320 + 42708082-42708324,42708359-42708409,42708987-427091... 28 7.8 01_06_1183 - 35176780-35177266,35179631-35181093 28 7.8 >07_03_1398 - 26271034-26271131,26271314-26271425,26271750-26271793, 26272158-26272485,26272569-26272982 Length = 331 Score = 30.3 bits (65), Expect = 1.5 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 6/63 (9%) Frame = +1 Query: 499 DIREKFGKDSNEDED-----KVES-VDETYENPYIVDKSQLEEIERKLEPLMSKNKRNSV 660 D+ E F +N+D+D ++E+ +E EN D S EE K EP++SKN+R + Sbjct: 202 DLEEDFVLVANQDDDDFVLVEIENQFEEEEENIAAADDS--EEDGLKNEPVLSKNRRKVM 259 Query: 661 ASP 669 P Sbjct: 260 TQP 262 >03_06_0722 - 35751490-35754357 Length = 955 Score = 30.3 bits (65), Expect = 1.5 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +1 Query: 520 KDSNEDEDKVESVDETYENPYIVDKSQLEEIERKLEPL 633 ++ ++DED+ E +E E P I D++ +E I K + L Sbjct: 207 QNEDKDEDESEEEEEEEEGPVIPDRATIEAIRAKRQQL 244 >02_03_0146 + 15720790-15721194,15721350-15721446,15721663-15721928, 15721997-15722437 Length = 402 Score = 29.9 bits (64), Expect = 1.9 Identities = 19/81 (23%), Positives = 42/81 (51%), Gaps = 4/81 (4%) Frame = +1 Query: 397 KMMTDEEKSKIAKLLHD----VAVKENQLPERCSGLVKDIREKFGKDSNEDEDKVESVDE 564 +++ E+K K +++ D +A++E + E+ L + + + G+ SN++ VES DE Sbjct: 283 ELLAKEDKKKAIQIMQDREIAMAIQEKEEKEQHKVLKRGLETR-GESSNKEIMAVESKDE 341 Query: 565 TYENPYIVDKSQLEEIERKLE 627 + + Q+ I+ +E Sbjct: 342 SLPMIKVGQNQQMRSIKEGME 362 >02_02_0238 + 8163922-8164362,8165008-8165118,8165205-8165249, 8166066-8166138,8166215-8166327,8166430-8166489, 8167287-8167334,8167422-8167490,8167618-8167679, 8167771-8167828 Length = 359 Score = 29.9 bits (64), Expect = 1.9 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = +1 Query: 517 GKDSNEDEDKVESVDETYENPYIVDKSQLEEIERKLEP 630 GK+ E+ KVE +E E Y D +LEE+ KL P Sbjct: 37 GKEEEEEAAKVEEEEEE-EREYKSDMRKLEELMSKLNP 73 >08_01_0329 - 2962018-2962695 Length = 225 Score = 29.5 bits (63), Expect = 2.6 Identities = 25/81 (30%), Positives = 38/81 (46%), Gaps = 1/81 (1%) Frame = +1 Query: 409 DEEKSKIAKLLHDVAVKENQLPERCSGLVKDIREKFGKDSNEDEDKVESVDETYENPYIV 588 D+E K+ + D A +L +G K K D E+E S + E+ Sbjct: 140 DDEVDKVMRWAMDAA----RLDVATAGAGKAKSTKKDDDEEEEEKDQTSSSVSSEDEEEE 195 Query: 589 DKSQLE-EIERKLEPLMSKNK 648 ++ +LE E ERK + +MSKNK Sbjct: 196 EEEKLEKERERKRKEMMSKNK 216 >05_05_0348 + 24271764-24271898,24273055-24273144,24273205-24273303, 24273725-24273826,24273912-24274088,24274193-24274398, 24274491-24274575,24274641-24274798,24274873-24274948, 24275117-24275245,24275313-24275457,24275561-24275691, 24276183-24276335,24276447-24276636,24277006-24277139, 24277248-24277406,24277659-24277964,24278040-24278216, 24278446-24278529,24278592-24278822,24278913-24279002, 24279090-24279211,24279293-24279448,24279477-24279635, 24279705-24279765,24280004-24280138,24280384-24280471, 24280548-24280620,24280883-24280994,24281691-24281711 Length = 1327 Score = 29.1 bits (62), Expect = 3.4 Identities = 20/75 (26%), Positives = 39/75 (52%) Frame = +1 Query: 406 TDEEKSKIAKLLHDVAVKENQLPERCSGLVKDIREKFGKDSNEDEDKVESVDETYENPYI 585 T+++ SKI + +V + +P+ + K ++EKF NE+E +E + E Sbjct: 417 TEKDTSKIDESTKEVEESSSLIPQLEEEIPK-LQEKF----NEEEKVLEQIKENSREETE 471 Query: 586 VDKSQLEEIERKLEP 630 +S+L ++ +LEP Sbjct: 472 RLRSKLTQVRSELEP 486 >11_06_0607 + 25437897-25438046,25438180-25438236,25438522-25438602, 25438720-25438777,25438888-25438991,25439064-25439115, 25439232-25439281,25440279-25440443,25440531-25440603, 25440714-25440846,25441146-25441203,25441411-25441458, 25441593-25441676,25441803-25441868,25442419-25442502 Length = 420 Score = 28.3 bits (60), Expect = 5.9 Identities = 15/42 (35%), Positives = 24/42 (57%) Frame = +1 Query: 520 KDSNEDEDKVESVDETYENPYIVDKSQLEEIERKLEPLMSKN 645 K++ +D D E +D E+ +QLEE+E KL+ L+ N Sbjct: 119 KENEDDPDMAEMIDSEMESL----SNQLEELEEKLKLLLLPN 156 >11_01_0635 - 5091381-5091562,5092800-5092866,5093079-5093960 Length = 376 Score = 28.3 bits (60), Expect = 5.9 Identities = 18/63 (28%), Positives = 31/63 (49%) Frame = +1 Query: 394 SKMMTDEEKSKIAKLLHDVAVKENQLPERCSGLVKDIREKFGKDSNEDEDKVESVDETYE 573 S T +S + L + KE ++ E ++ E +DS+EDED+ E ++Y Sbjct: 300 SSTCTGSRESHSSDLFQVFSFKEIEILEGYDNDQDEVEEDEDEDSHEDEDENE---DSYG 356 Query: 574 NPY 582 +PY Sbjct: 357 DPY 359 >04_04_1365 - 32967604-32968367,32969097-32969221,32969583-32969632 Length = 312 Score = 28.3 bits (60), Expect = 5.9 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -2 Query: 360 YKIYCRLGNHWHRCSHSQINLV 295 Y Y RL NHW++C + + V Sbjct: 260 YVTYLRLNNHWYKCDDAWVTRV 281 >03_05_0354 + 23411485-23411802,23411886-23412176,23414610-23414675, 23415186-23415645,23415963-23416189,23416362-23416649, 23416955-23416966 Length = 553 Score = 28.3 bits (60), Expect = 5.9 Identities = 17/38 (44%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +1 Query: 475 ERCSGLVKDIRE--KFGKDSNEDEDKVESVDETYENPY 582 ER +D RE K G D +EDED+ E VD+ E+ Y Sbjct: 16 ERACLAEQDHREEKKEGDDEDEDEDEDEDVDKDGEDRY 53 >02_01_0369 + 2649178-2655291,2655773-2656601,2656737-2657425, 2657523-2657649,2657731-2657812,2658172-2658196 Length = 2621 Score = 28.3 bits (60), Expect = 5.9 Identities = 22/95 (23%), Positives = 53/95 (55%), Gaps = 5/95 (5%) Frame = +1 Query: 358 INNTKPDI--IEQFSKMMTDEEKS---KIAKLLHDVAVKENQLPERCSGLVKDIREKFGK 522 + N + +I +E+ S+M+ +++K+ ++++L AV +Q G +KD+ ++ K Sbjct: 2257 LENARMEIHNLEKHSEMLLNQKKNLETQVSELKDMEAVAHDQ-----HGRIKDLSDELSK 2311 Query: 523 DSNEDEDKVESVDETYENPYIVDKSQLEEIERKLE 627 E E ++++DE E V +++ ++E+ L+ Sbjct: 2312 KDQEIEGLMQALDEE-ERELEVLENKSNDLEKMLQ 2345 >04_04_0076 + 22558105-22558261,22558356-22558405,22559837-22560044, 22560112-22560237,22560469-22560567,22560729-22561405, 22561483-22561731,22561808-22561936,22562021-22562089, 22562183-22562256,22563086-22563098,22563361-22563468, 22563541-22563651,22563725-22563811,22564043-22564068, 22564840-22564906,22565123-22565212,22565295-22565387, 22565515-22565604,22565699-22565761,22566349-22566447 Length = 894 Score = 27.9 bits (59), Expect = 7.8 Identities = 20/81 (24%), Positives = 38/81 (46%) Frame = +1 Query: 406 TDEEKSKIAKLLHDVAVKENQLPERCSGLVKDIREKFGKDSNEDEDKVESVDETYENPYI 585 T+ + +IAK V ENQ+ + CS + D +E+ + E E +E + Sbjct: 471 TESLQGEIAKRDQQVETLENQVNQLCS--IIDEKEQLHTCAVEREKNLEEQKLQVQASLA 528 Query: 586 VDKSQLEEIERKLEPLMSKNK 648 +SQL E +++ + ++ K Sbjct: 529 ATESQLTEAKKQYDIMLEGKK 549 >02_04_0448 - 23001579-23001683,23001783-23002382,23002479-23002628, 23002788-23003015,23003188-23003302,23003392-23004659, 23006621-23006692 Length = 845 Score = 27.9 bits (59), Expect = 7.8 Identities = 18/74 (24%), Positives = 34/74 (45%) Frame = +1 Query: 439 LHDVAVKENQLPERCSGLVKDIREKFGKDSNEDEDKVESVDETYENPYIVDKSQLEEIER 618 LHD A+ + P R + + + + +D D + T E+P KS ++E+ Sbjct: 86 LHDAAIHQKLNPLRINVQLNNSHTAAPQAKQQDSDNIPLRSTTTEDPLAHIKSVIDEV-- 143 Query: 619 KLEPLMSKNKRNSV 660 L+P+ K+ + V Sbjct: 144 -LKPISMKSIQEPV 156 >01_07_0320 + 42708082-42708324,42708359-42708409,42708987-42709122, 42709226-42709275,42709978-42710066,42710398-42710434, 42710435-42710471,42710588-42710733,42711099-42711241, 42711735-42711768,42711962-42712064,42712236-42712381, 42712982-42713323,42713416-42713656,42713733-42713788, 42713852-42713920 Length = 640 Score = 27.9 bits (59), Expect = 7.8 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 159 NVYREFLFVLPSTCLHQNEFISWCFKFIKPTT 254 N+Y +FL + STC ++ + W F I+ TT Sbjct: 446 NIYGDFLQEITSTCCLEDVEMGWAFCPIRVTT 477 >01_06_1183 - 35176780-35177266,35179631-35181093 Length = 649 Score = 27.9 bits (59), Expect = 7.8 Identities = 20/75 (26%), Positives = 37/75 (49%) Frame = +1 Query: 406 TDEEKSKIAKLLHDVAVKENQLPERCSGLVKDIREKFGKDSNEDEDKVESVDETYENPYI 585 +DE ++++ +L HD+A + LP GL D+ + S + + E+ E Sbjct: 118 SDEMEAELRELNHDLATLLDLLPVVELGLADDVLDVLALASRQCR-RCSPAPESEEALKA 176 Query: 586 VDKSQLEEIERKLEP 630 S ++EIER++ P Sbjct: 177 SVLSLIQEIEREIVP 191 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,408,072 Number of Sequences: 37544 Number of extensions: 329250 Number of successful extensions: 889 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 860 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 885 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1714968940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -