BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10g19 (676 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 39 0.004 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 34 0.091 SB_22025| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.12) 33 0.28 SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.37 SB_56834| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.64 SB_40923| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.29) 31 0.85 SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) 31 1.1 SB_8758| Best HMM Match : E-MAP-115 (HMM E-Value=0.25) 30 1.5 SB_23180| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_6594| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_39733| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.0 SB_17534| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.51) 30 2.0 SB_41007| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 29 2.6 SB_36643| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_2282| Best HMM Match : PHZA_PHZB (HMM E-Value=4.4) 29 2.6 SB_47535| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_51841| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_59316| Best HMM Match : LRR_1 (HMM E-Value=0) 28 6.0 SB_44482| Best HMM Match : RRM_1 (HMM E-Value=0.19) 28 6.0 SB_39171| Best HMM Match : EzrA (HMM E-Value=0.16) 28 6.0 SB_33387| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_16527| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_8756| Best HMM Match : DUF1168 (HMM E-Value=1) 28 6.0 SB_38099| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.0 SB_59580| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) 28 7.9 SB_53789| Best HMM Match : ResIII (HMM E-Value=0.044) 28 7.9 SB_18016| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.9 SB_1074| Best HMM Match : ScdA_N (HMM E-Value=2.4) 28 7.9 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 38.7 bits (86), Expect = 0.004 Identities = 22/66 (33%), Positives = 40/66 (60%), Gaps = 5/66 (7%) Frame = +1 Query: 445 DVAVKENQLPERCSGLV----KDIREKFGKDSNEDEDKVE-SVDETYENPYIVDKSQLEE 609 +V E++L ++C LV K+++EK+ + NE +KVE ++ + YE + +S+LEE Sbjct: 545 EVKFIEDELKKQCKALVEKKAKELKEKYQGELNEKVNKVERTLRKQYEEDIVKGRSELEE 604 Query: 610 IERKLE 627 R L+ Sbjct: 605 TNRTLK 610 Score = 30.3 bits (65), Expect = 1.5 Identities = 19/68 (27%), Positives = 33/68 (48%) Frame = +1 Query: 448 VAVKENQLPERCSGLVKDIREKFGKDSNEDEDKVESVDETYENPYIVDKSQLEEIERKLE 627 V + L ERC V ++EK D + +DK + ++ E + ++ ++ERKL+ Sbjct: 1586 VETLQELLRERCEE-VDVLKEKIS-DKRQVQDKNPASNDKAEEEASTKEERVNDLERKLD 1643 Query: 628 PLMSKNKR 651 L N R Sbjct: 1644 ELQQSNTR 1651 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 34.3 bits (75), Expect = 0.091 Identities = 20/81 (24%), Positives = 41/81 (50%), Gaps = 5/81 (6%) Frame = +1 Query: 397 KMMTDEEKSKIAKLLHDVAVKENQLPERCSGLVKDIREKFGKDSNEDEDKVESVD----- 561 ++ E KS+ ++ H+V + L + + + K R+ F KD+ ++E +D Sbjct: 2356 RIENSESKSRFTQINHEVLSLQKDLANKTAQITKFQRDTFDKDNRLTTLEIEKIDIEKKL 2415 Query: 562 ETYENPYIVDKSQLEEIERKL 624 E+ ++ Y +K++L E E L Sbjct: 2416 ESLKDEYSGEKTKLVEAEGNL 2436 >SB_22025| Best HMM Match : TPR_MLP1_2 (HMM E-Value=0.12) Length = 495 Score = 32.7 bits (71), Expect = 0.28 Identities = 28/93 (30%), Positives = 44/93 (47%), Gaps = 4/93 (4%) Frame = +1 Query: 397 KMMTDEEKSKIAKLLHDVAVKENQLPERCSGLVKDIREKFGKDSNEDEDKVESVDETYEN 576 K+M EE+ K+A L + EN DI+ K+G+ S E E+ V+ +DE Sbjct: 65 KIMMKEEELKMAAELGKKMLAEND----------DIKMKYGELSREHEEVVKELDEEITR 114 Query: 577 PYIVDKSQL----EEIERKLEPLMSKNKRNSVA 663 D++ L + ++ K E M KNK +A Sbjct: 115 -VTTDRNNLRTSMKTLQAKYEQAMQKNKEYEIA 146 >SB_320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1040 Score = 32.3 bits (70), Expect = 0.37 Identities = 21/97 (21%), Positives = 49/97 (50%), Gaps = 3/97 (3%) Frame = +1 Query: 370 KPDIIEQFSKMMTDEEKSKIAKLLHDVAVKENQLPERCSGLVKDIREKFGKDSNEDEDKV 549 K + ++ +M D + K ++ L + K ++ E+ ++D+ EKF K+ D+V Sbjct: 356 KAGLPKEVLSLMNDAREEKRSENLSKMEKKLSETQEK----LQDMEEKFSKEKRAWADEV 411 Query: 550 ESVDETYENPYIV---DKSQLEEIERKLEPLMSKNKR 651 ES++ ++ ++ +S+L E + L +N++ Sbjct: 412 ESLETDVKSLQLISDESESKLREAQSSLREYREENRK 448 >SB_56834| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 552 Score = 31.5 bits (68), Expect = 0.64 Identities = 18/56 (32%), Positives = 34/56 (60%), Gaps = 3/56 (5%) Frame = +1 Query: 508 EKFGKDSNEDEDKVESVDETYENPYIVDK-SQLEEIERKLEP--LMSKNKRNSVAS 666 E+ G+D +++E++ E DE+ E+ Y+ ++ S+ + K+ P L SK+ S AS Sbjct: 418 EENGEDDDDEEEEEEDSDESEESEYLEEQPSRRSTVRPKVRPTALPSKSGSRSAAS 473 >SB_40923| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.29) Length = 690 Score = 31.1 bits (67), Expect = 0.85 Identities = 20/92 (21%), Positives = 47/92 (51%), Gaps = 6/92 (6%) Frame = +1 Query: 403 MTDEEKSKIAKLLHDVAVKEN---QLPERCSGLVKDI---REKFGKDSNEDEDKVESVDE 564 M DE+++K +L D+ + N +L E+ L + +E++ + + E+++ + Sbjct: 436 MLDEKQAKYTSMLKDLKNERNKIIELEEKLKALEEQNSQRQEEYDSNKSTHENELLVLKA 495 Query: 565 TYENPYIVDKSQLEEIERKLEPLMSKNKRNSV 660 +E K QLEE+E++ ++K + ++ Sbjct: 496 KHEEELKETKQQLEELEKEKSEKLTKEQEEAL 527 >SB_59515| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2e-31) Length = 2122 Score = 30.7 bits (66), Expect = 1.1 Identities = 25/81 (30%), Positives = 46/81 (56%), Gaps = 2/81 (2%) Frame = +1 Query: 415 EKSKIAKLLHDVAVKENQLPERCSGLVKDIREK-FGKDSNEDEDKVESVDETYENPYIVD 591 E+SK+ +L+H++A + +L E S V ++R+K GK E+ E + ++ + D Sbjct: 406 ERSKVKELVHEIAELKEKLQE--SEKVIELRKKDLGKKDKTIEELKERIIVLEKS--LKD 461 Query: 592 KS-QLEEIERKLEPLMSKNKR 651 K+ ++ IE K+ L +KN R Sbjct: 462 KNDEIFGIEGKIAELEAKNDR 482 >SB_8758| Best HMM Match : E-MAP-115 (HMM E-Value=0.25) Length = 322 Score = 30.3 bits (65), Expect = 1.5 Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 4/87 (4%) Frame = +1 Query: 412 EEKSKIAKLLHDVAVKENQL---PERCSGLVKDIREKFGKDSNEDEDKVESVDETYENPY 582 E K + + HD +KE ER L ++ + K +++DKV+ DET E Sbjct: 85 EFKELVRIIEHDRKLKEFMRVKGEERADMLEGELSSR--KKKKDEKDKVDKADETIEAKA 142 Query: 583 IVDKSQLEEIERKLE-PLMSKNKRNSV 660 ++K + E +E + E + KNK + Sbjct: 143 DIEKFKSEGVEMEAERKAILKNKEEKL 169 >SB_23180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 226 Score = 29.9 bits (64), Expect = 2.0 Identities = 18/67 (26%), Positives = 31/67 (46%) Frame = +1 Query: 415 EKSKIAKLLHDVAVKENQLPERCSGLVKDIREKFGKDSNEDEDKVESVDETYENPYIVDK 594 EK K+L + Q+ E+ + +V D + G + N + KV + + E P V Sbjct: 9 EKESPWKILLFILTDPQQMQEK-TNIVADNAARLGLNINRGKSKVFKTNASNETPITVQG 67 Query: 595 SQLEEIE 615 LEE++ Sbjct: 68 EALEEVD 74 >SB_6594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 29.9 bits (64), Expect = 2.0 Identities = 25/81 (30%), Positives = 41/81 (50%), Gaps = 1/81 (1%) Frame = +1 Query: 415 EKSKIAKLLHDVAVKENQLPERCSGLVKDIREKFGKDSNEDEDKVES-VDETYENPYIVD 591 EK K K + A+K+N+L R K+I E G ++E+ +K+ S +D E ++D Sbjct: 378 EKQKFRKTPFNYAIKKNELIRR-----KEIAETSG--NHEEAEKIRSELDNLEERAQVLD 430 Query: 592 KSQLEEIERKLEPLMSKNKRN 654 K + R L + N+RN Sbjct: 431 KQR----SRGLSAISYINERN 447 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 29.9 bits (64), Expect = 2.0 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 2/80 (2%) Frame = +1 Query: 343 ATVYFINNTKPDIIEQFSKMM--TDEEKSKIAKLLHDVAVKENQLPERCSGLVKDIREKF 516 A V I T I F++++ T++ +K+ K + + K + ER K R++ Sbjct: 448 AAVGHIEQTLISITAYFTRLIQETNQRAAKVEKGIQEKITKAEEYLERLESNEK--RKQE 505 Query: 517 GKDSNEDEDKVESVDETYEN 576 G N D++ E+ +ETYEN Sbjct: 506 GTYGN-DKETYENDEETYEN 524 >SB_39733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2839 Score = 29.9 bits (64), Expect = 2.0 Identities = 25/96 (26%), Positives = 48/96 (50%), Gaps = 5/96 (5%) Frame = +1 Query: 379 IIEQFSKMMTDEEKSKIAKLLHDVAVKENQLP-ERCSGLVKDIRE-KFGKDSNEDEDKVE 552 II+Q + + E + A+LL + + E + ER +++ + ++ + E+ED+ + Sbjct: 2219 IIQQ--RQEEERESQRKARLLEEQRLLEERAEMERAKRELEERKAARYHEPQEEEEDEED 2276 Query: 553 SVDETYENPYIV---DKSQLEEIERKLEPLMSKNKR 651 +V+ + E P V D SQ + +R EP K R Sbjct: 2277 AVNVSPEKPQNVRKLDLSQFSKFQRAAEPTPQKPPR 2312 >SB_17534| Best HMM Match : Merozoite_SPAM (HMM E-Value=0.51) Length = 976 Score = 29.9 bits (64), Expect = 2.0 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = +1 Query: 508 EKFGKDSNEDEDKVESVDETYENPYIVDKSQLEEIERKLE 627 EK KD ++D+D+ + ++ E +D+ +EEIE LE Sbjct: 463 EKKDKDKDKDKDEEDDSSDSEEEREAMDEMIMEEIEAALE 502 >SB_41007| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 278 Score = 29.5 bits (63), Expect = 2.6 Identities = 20/62 (32%), Positives = 34/62 (54%) Frame = +1 Query: 490 LVKDIREKFGKDSNEDEDKVESVDETYENPYIVDKSQLEEIERKLEPLMSKNKRNSVASP 669 L +DI + F D NE D+ +D+ EN +D QL+++E+ P+ + N +AS Sbjct: 146 LQRDITDYFDDDDNELLDEDLFLDDIEEN---LDFDQLDQLEKGALPIRNSASEN-IASL 201 Query: 670 NL 675 +L Sbjct: 202 HL 203 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 29.5 bits (63), Expect = 2.6 Identities = 15/49 (30%), Positives = 29/49 (59%) Frame = +1 Query: 520 KDSNEDEDKVESVDETYENPYIVDKSQLEEIERKLEPLMSKNKRNSVAS 666 +D E+E++ + VDE+ ++ ++ QLEE ER ++ + K + V S Sbjct: 3241 EDICEEEEEEKDVDESVDDKDFEERRQLEEYERLESFVLLEEKLSQVES 3289 >SB_36643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 537 Score = 29.5 bits (63), Expect = 2.6 Identities = 19/73 (26%), Positives = 35/73 (47%) Frame = +1 Query: 397 KMMTDEEKSKIAKLLHDVAVKENQLPERCSGLVKDIREKFGKDSNEDEDKVESVDETYEN 576 K + D + + +A L H + Q+ E+ + +V D K G + N + K+ + + E Sbjct: 331 KQLDDLDFADLALLFHT----QQQMQEK-TNIVADNSAKLGLNINRGKSKMFKTNASNET 385 Query: 577 PYIVDKSQLEEIE 615 P V LEE++ Sbjct: 386 PITVQGETLEEVD 398 >SB_2282| Best HMM Match : PHZA_PHZB (HMM E-Value=4.4) Length = 660 Score = 29.5 bits (63), Expect = 2.6 Identities = 19/72 (26%), Positives = 35/72 (48%) Frame = +1 Query: 451 AVKENQLPERCSGLVKDIREKFGKDSNEDEDKVESVDETYENPYIVDKSQLEEIERKLEP 630 ++++ + P +GLV++I DED E V P + +K EE+ R+L+P Sbjct: 11 SMRDKEAPAVLAGLVQNIL---------DEDITEDVKHRLLKPLVPEKVWTEEVWRELDP 61 Query: 631 LMSKNKRNSVAS 666 L+ ++ S Sbjct: 62 LLPGRRQEGPES 73 >SB_47535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 298 Score = 29.1 bits (62), Expect = 3.4 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = +1 Query: 433 KLLHDVAVKENQLPERCSGLVKDIREKFGKDSNEDEDKVES-VDETYENPYIVDKSQLE 606 K L +VA ++ S + + I K +D N D ++ V+E NPY++DK + + Sbjct: 161 KFLKEVAKNPQKIWVEKSNMHRGIHIKKPQDINLDSSSRDTFVEEFISNPYLIDKRKCD 219 >SB_51841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 29.1 bits (62), Expect = 3.4 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 3/71 (4%) Frame = +1 Query: 463 NQLPERCSGLVKDIREKFGKDSNEDEDKVESVDETYENPYIVDKSQLEEIERK---LEPL 633 N +R V++ +EK ++ED K+E ++ N I++ + E+E K L+ + Sbjct: 16 NGYVQRNLSFVRNRKEKIDYKTDEDLAKLEMMNTKKPNKEILEHQKKREVELKCMELQDM 75 Query: 634 MSKNKRNSVAS 666 M + R SV S Sbjct: 76 MEEQGRCSVDS 86 >SB_59316| Best HMM Match : LRR_1 (HMM E-Value=0) Length = 680 Score = 28.3 bits (60), Expect = 6.0 Identities = 24/92 (26%), Positives = 37/92 (40%) Frame = +1 Query: 382 IEQFSKMMTDEEKSKIAKLLHDVAVKENQLPERCSGLVKDIREKFGKDSNEDEDKVESVD 561 +E ++ D K KI + PE+ L ++ R K D ED +S+ Sbjct: 448 LENLMRLDLDGNKLKIKADKVPKLTTKVLYPEKDPALKENWRGKVRGDKLAGEDFSQSIA 507 Query: 562 ETYENPYIVDKSQLEEIERKLEPLMSKNKRNS 657 E ENP + EE E E + S +R + Sbjct: 508 ELLENPEEAQSNGGEEEEECEETVYSPGEREA 539 >SB_44482| Best HMM Match : RRM_1 (HMM E-Value=0.19) Length = 486 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +1 Query: 484 SGLVKDIREKFGKDSNEDEDK 546 SGL KD ++FG +S EDE + Sbjct: 217 SGLSKDAADRFGNESGEDEPR 237 >SB_39171| Best HMM Match : EzrA (HMM E-Value=0.16) Length = 587 Score = 28.3 bits (60), Expect = 6.0 Identities = 20/91 (21%), Positives = 49/91 (53%), Gaps = 2/91 (2%) Frame = +1 Query: 382 IEQFSKMMTDEEKSKIAKLLHDVAVKENQLPERCSGLVKDIR--EKFGKDSNEDEDKVES 555 I+ ++++T++ K+++ +L+ +EN L++ IR E+ G+ + DK+E+ Sbjct: 249 IDSSNRLLTEKHKAEMLRLVSQKLEEENNWVTERQKLIEKIRELEELGRCQKDAIDKLEN 308 Query: 556 VDETYENPYIVDKSQLEEIERKLEPLMSKNK 648 + +D ++++ +R+LE +NK Sbjct: 309 SCHLKND---LD-FEIQQRDRELERAKKENK 335 >SB_33387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 888 Score = 28.3 bits (60), Expect = 6.0 Identities = 20/79 (25%), Positives = 34/79 (43%) Frame = +1 Query: 364 NTKPDIIEQFSKMMTDEEKSKIAKLLHDVAVKENQLPERCSGLVKDIREKFGKDSNEDED 543 +T + E K++T E + K L + + Q E + + E K +NE Sbjct: 785 STVQQLCEVEGKLVTRESE---VKSLREELTRMQQGSEELKKKIASLEESLIKANNEIGK 841 Query: 544 KVESVDETYENPYIVDKSQ 600 ES+D + +P VDK + Sbjct: 842 SQESLDSIHNSPEKVDKKK 860 >SB_16527| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 518 Score = 28.3 bits (60), Expect = 6.0 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +1 Query: 535 DEDKVESVDETYENPYIVDKSQLEEIERKLEPLMSKNKRNSVAS 666 DED + V P + K EE+ R+ +PLMS ++ S Sbjct: 126 DEDIPDDVKHKLLKPLVPAKVWTEEVRREFDPLMSGRRQKGPES 169 >SB_8756| Best HMM Match : DUF1168 (HMM E-Value=1) Length = 346 Score = 28.3 bits (60), Expect = 6.0 Identities = 24/80 (30%), Positives = 41/80 (51%), Gaps = 1/80 (1%) Frame = +1 Query: 340 KATVYFINNTKPDIIEQFSKMMTDEE-KSKIAKLLHDVAVKENQLPERCSGLVKDIREKF 516 KA + IN K D + ++ E KS+ ++ A+ EN ER S + RE F Sbjct: 165 KANLLLIN--KADYLTPSQRLKWAEYYKSRNIQVAFWSALAEN---ERLSEEQEKSREDF 219 Query: 517 GKDSNEDEDKVESVDETYEN 576 ++++ E+K E +DE+ E+ Sbjct: 220 TQETDSTEEKKEKIDESEED 239 >SB_38099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 380 Score = 28.3 bits (60), Expect = 6.0 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = -3 Query: 170 PIYIPSIPKNAAHGNKKQNNFILGHN 93 P+Y P+ + N +NNFILG N Sbjct: 252 PVYHPTFQNMYVYSNITENNFILGSN 277 >SB_59580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 999 Score = 27.9 bits (59), Expect = 7.9 Identities = 16/66 (24%), Positives = 35/66 (53%), Gaps = 2/66 (3%) Frame = +1 Query: 385 EQFSKMMTDEEKSKIAKLLHDV--AVKENQLPERCSGLVKDIREKFGKDSNEDEDKVESV 558 E+ K + K+K AK + + K+ +L E +++++++ K+ E +DK S Sbjct: 824 EEEEKELEKRSKTKDAKKYFESWKSKKDEELKEAHRAKMQELKKQKQKEEEEKQDKTLSS 883 Query: 559 DETYEN 576 +++EN Sbjct: 884 KKSFEN 889 >SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) Length = 2858 Score = 27.9 bits (59), Expect = 7.9 Identities = 22/95 (23%), Positives = 43/95 (45%), Gaps = 2/95 (2%) Frame = +1 Query: 364 NTKPDIIEQFSKMMTDEEKSKIAKLLHDVAVKENQLPERCSGLVKDIREKFGKDSNEDE- 540 NTK DI+E +K M D + + K D + Q + + L DI+EK + S + Sbjct: 574 NTKNDILEDQAKEMHD-DLLEANKRAADAEDELQQTEDELNRLKNDIQEKEKRISELESA 632 Query: 541 -DKVESVDETYENPYIVDKSQLEEIERKLEPLMSK 642 D + E + +++ +E +L+ +++ Sbjct: 633 FDAADKEKRDLEQQVLSQTPKIKRLESELQDALNR 667 >SB_53789| Best HMM Match : ResIII (HMM E-Value=0.044) Length = 942 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +1 Query: 535 DEDKVESVDETYENPYIVDKSQLEEIERKLEPLMSK 642 DED E V P ++ +++ EE+ RK +PL+ + Sbjct: 30 DEDIPEDVKHKLLKPLVLAEARPEEVWRKFDPLLEQ 65 >SB_18016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 573 Score = 27.9 bits (59), Expect = 7.9 Identities = 10/26 (38%), Positives = 19/26 (73%) Frame = +1 Query: 592 KSQLEEIERKLEPLMSKNKRNSVASP 669 + +L+EI RK+ L+ KN++N + +P Sbjct: 80 RDRLKEINRKISDLICKNRKNILQAP 105 >SB_1074| Best HMM Match : ScdA_N (HMM E-Value=2.4) Length = 694 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/72 (23%), Positives = 35/72 (48%) Frame = +1 Query: 451 AVKENQLPERCSGLVKDIREKFGKDSNEDEDKVESVDETYENPYIVDKSQLEEIERKLEP 630 ++++ + P +GLV++I DED ++ V P + +K EE+ R+ +P Sbjct: 11 SMRDKEAPAVLAGLVQNIL---------DEDIIDDVKHRLLKPLVPEKVWTEEVWREFDP 61 Query: 631 LMSKNKRNSVAS 666 L+ ++ S Sbjct: 62 LLPGRRQEGPES 73 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,783,535 Number of Sequences: 59808 Number of extensions: 415511 Number of successful extensions: 1331 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 1225 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1326 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1733301648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -