BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10g19 (676 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein ... 25 0.87 AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 23 2.7 >DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein 5 protein. Length = 104 Score = 24.6 bits (51), Expect = 0.87 Identities = 12/35 (34%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = -2 Query: 342 LGNHWHRCSHSQINLVGSERRFL-QFFNLVWWLVL 241 L NH +RC+ QI + + F+ Q + W L+L Sbjct: 61 LNNHCNRCTSRQIGIANTLIPFMQQNYPYEWQLIL 95 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 23.0 bits (47), Expect = 2.7 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = -3 Query: 185 YEKKFPIYIPSIPKNAAHGN----KKQNNFILGHNMNIGAQLNIFINFHSQNL 39 YEK Y+ I K+A N K + + N +G Q+N FIN +S+ L Sbjct: 166 YEKNGETYL-RIKKHAVKFNPAKVKLRFENLFDGNKELGEQMNRFINENSELL 217 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,244 Number of Sequences: 438 Number of extensions: 4251 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20464920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -