BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10g18 (635 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 25 1.5 AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. 24 3.5 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 24 4.6 L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. 23 8.1 AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhi... 23 8.1 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 25.4 bits (53), Expect = 1.5 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = +3 Query: 279 ARCRYSNGGTCSTNKTDEDGCEVRDIYAIRSH 374 +RCR +NG TN+ +G +V D+ +H Sbjct: 428 SRCRNTNGALQQTNRC--EGLKVGDVVTFEAH 457 >AJ130951-1|CAA10260.1| 189|Anopheles gambiae SG3 protein protein. Length = 189 Score = 24.2 bits (50), Expect = 3.5 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = +2 Query: 203 WYMLPQLRPQRPWWYP 250 W+ +P + P RP W+P Sbjct: 83 WWSVPGIPPFRPPWHP 98 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 23.8 bits (49), Expect = 4.6 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = +3 Query: 78 NGTCQSLKTN*INRSIENKQNSNNVAKAAALNFIREHW 191 NG+C S ++ N S + +SN+ A + H+ Sbjct: 1087 NGSCSSTSSSHSNHSSHSSSSSNSAGSWAGMGKQESHY 1124 >L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. Length = 511 Score = 23.0 bits (47), Expect = 8.1 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = +3 Query: 189 WSPVCGTCCHNYDPRDHGGIQI 254 WS + C P+ +GG+Q+ Sbjct: 43 WSDIADECERFLGPKGYGGVQL 64 >AY928182-1|AAX22219.1| 335|Anopheles gambiae phenoloxidase inhibitor protein protein. Length = 335 Score = 23.0 bits (47), Expect = 8.1 Identities = 11/34 (32%), Positives = 14/34 (41%), Gaps = 1/34 (2%) Frame = +3 Query: 300 GGTCSTNKTDEDGCEVRDIYAIRSHGYCS-ACAK 398 GGT T C +Y + + CS AC K Sbjct: 218 GGTVDETSTGTPKCTSNGLYCVHNKDCCSGACYK 251 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 660,618 Number of Sequences: 2352 Number of extensions: 13227 Number of successful extensions: 35 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62305095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -