BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10g18 (635 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 4.3 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 5.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 7.6 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 22.2 bits (45), Expect = 4.3 Identities = 7/25 (28%), Positives = 13/25 (52%) Frame = +3 Query: 462 RICYDSGWKIIQSVRQRKERGCSNI 536 ++ Y W++ ++ R E CS I Sbjct: 97 KVTYSGLWRVCVAISSRMEYECSRI 121 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.8 bits (44), Expect = 5.7 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = +1 Query: 217 TITTPETMVVSRSDDAETEATLDVDTVTEGPVQPIKLTKMDVKSVIS 357 TI TP T V+S S +L + + + K DVK+ I+ Sbjct: 838 TINTPTTSVISMSGTTVPITSLPASSTSINSITVEKDVINDVKTQIT 884 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 7.6 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 215 PQLRPQRPWWYP 250 PQL+PQ+P+ P Sbjct: 1124 PQLKPQKPFTSP 1135 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,097 Number of Sequences: 438 Number of extensions: 3710 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19071468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -