BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10g16 (670 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g65110.1 68414.m07381 ubiquitin carboxyl-terminal hydrolase-r... 31 0.92 At3g07880.1 68416.m00963 Rho GDP-dissociation inhibitor family p... 29 2.1 At3g56300.1 68416.m06258 tRNA synthetase class I (C) family prot... 28 6.5 At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical ... 28 6.5 >At1g65110.1 68414.m07381 ubiquitin carboxyl-terminal hydrolase-related contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 1094 Score = 30.7 bits (66), Expect = 0.92 Identities = 18/56 (32%), Positives = 34/56 (60%) Frame = +3 Query: 252 ATTNSHKTKLKPLKNVTRRASINAVSRSVRCSLL*HTLPSNMDI*NQTQDLVHSQR 419 + TN+H+ +K LKN+ + S++ + R S L TL + ++I +DLVH+++ Sbjct: 749 SNTNNHEEAIKDLKNMPTKDSLSEDATRYR-SALDMTLKALLNIKVLQEDLVHNRQ 803 >At3g07880.1 68416.m00963 Rho GDP-dissociation inhibitor family protein similar to SP|P52565 Rho GDP-dissociation inhibitor 1 (Rho GDI 1) (Rho-GDI alpha) {Homo sapiens}; contains Pfam profile PF02115: RHO protein GDP dissociation inhibitor Length = 240 Score = 29.5 bits (63), Expect = 2.1 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Frame = +3 Query: 135 SGTLWLEKVKM*RRKIVIVTRS--LAPATHVLPSETSHTHCATTNSHKTKLK 284 + T+W VK+ R K ++ T S L P HV+P ET+ + S+ + K Sbjct: 164 TNTVWKTGVKVDRAKEMLGTFSPQLEPYNHVMPEETTPSGMFARGSYSARTK 215 >At3g56300.1 68416.m06258 tRNA synthetase class I (C) family protein similar to cysteinyl-tRNA synthetase [Methanococcus maripaludis] GI:6599476; contains Pfam profile PF01406: tRNA synthetases class I (C) Length = 489 Score = 27.9 bits (59), Expect = 6.5 Identities = 20/99 (20%), Positives = 47/99 (47%) Frame = +2 Query: 14 YDIRQSTILEQNKSKIIVMHYF*TKKERSPSYLSITMIM*FRDAMVGKSKDVKEEDCDCY 193 + IRQ + N + + H+ + + RSP S++ + DA+ S +E D Sbjct: 267 FTIRQ---IAANYHPLALRHFLMSAQYRSPLNYSVSQLESSSDALYSLSPYREEMSGDVG 323 Query: 194 AESRTSDACPPIRNVTHPLRYYEFTQDEIKALEECDKES 310 ++++A I+ V + L++ + ++K +++ + S Sbjct: 324 KTQQSAEAKEMIKKVKNALKFINVSISKLKKMQKKQRMS 362 >At3g13530.1 68416.m01701 MAP3K epsilon protein kinase identical to MAP3K epsilon protein kinase [Arabidopsis thaliana] gi|3549652|emb|CAA12272 Length = 1368 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/28 (46%), Positives = 18/28 (64%) Frame = +2 Query: 383 LKPNPRFGPFPKVTLAVVVGYFLGKLSY 466 +KPN +FGPFP+ +AV + L L Y Sbjct: 108 IKPN-KFGPFPESLVAVYIAQVLEGLVY 134 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,499,687 Number of Sequences: 28952 Number of extensions: 337581 Number of successful extensions: 949 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 929 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 949 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1412971776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -