BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10g14 (735 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding pr... 26 1.4 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 23 7.4 >AY146732-1|AAO12092.1| 327|Anopheles gambiae odorant-binding protein AgamOBP44 protein. Length = 327 Score = 25.8 bits (54), Expect = 1.4 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = -1 Query: 333 SSISISVTARC-ILALS-GGRFLHRTCATVSGNVYIWTASFDRYRT 202 ++ I++T C +ALS GGR TC+ SG ++ S+ Y++ Sbjct: 269 AAAKIALTNLCPAVALSYGGRKPSSTCSKASGTGQVYNLSYPGYKS 314 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 23.4 bits (48), Expect = 7.4 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 577 NNGRRIC*GRYHDE*RRMSDNDKCECSRCHE 669 NNGR + YH + R +SDND+ + H+ Sbjct: 542 NNGRVL----YHPDLRPLSDNDQYSATLKHK 568 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 719,623 Number of Sequences: 2352 Number of extensions: 15515 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 75260343 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -