BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10g12 (746 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_57902| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_56059| Best HMM Match : Zw10 (HMM E-Value=0.37) 29 5.3 SB_21167| Best HMM Match : KH_1 (HMM E-Value=0) 29 5.3 SB_19734| Best HMM Match : RNA_pol_Rpb1_5 (HMM E-Value=0) 28 7.0 >SB_53865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = -3 Query: 126 VRISRHDIVIIVLWHELPTAQKTVIQ*YYEGTHFFRRSH 10 + +R+ +IIV+ E+P T+I ++ H+F R H Sbjct: 550 ITCTRYGTIIIVITTEMPIVTTTIIHYHHCQHHYFHRFH 588 >SB_57902| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 430 Score = 29.1 bits (62), Expect = 4.0 Identities = 18/46 (39%), Positives = 28/46 (60%), Gaps = 1/46 (2%) Frame = +1 Query: 265 KKWALCV-LMKLGLMTAQGVFKMNEAMSKIPDMNDKIIAEKLIDDC 399 K W L + L+K+ ++TAQ VF ++ KIP D A+ ++DDC Sbjct: 116 KPWKLLIQLIKIIIVTAQIVFDNSKHDGKIPVTLD---ADGIMDDC 158 >SB_56059| Best HMM Match : Zw10 (HMM E-Value=0.37) Length = 396 Score = 28.7 bits (61), Expect = 5.3 Identities = 16/65 (24%), Positives = 30/65 (46%) Frame = +1 Query: 82 MPEDYYYDIVTRDPDDLMREKENEVRALRAFQADCAEDVQVKPDLVVNLKSGDWQTEDVS 261 +PED YY + D +++E NEV L +D A + ++V+N + + Sbjct: 272 LPEDLYYHSLGALLDAVIQEITNEVLKLEDLSSDEAHQLNFLLNVVINKAPELFPDPSTA 331 Query: 262 LKKWA 276 + W+ Sbjct: 332 IPHWS 336 >SB_21167| Best HMM Match : KH_1 (HMM E-Value=0) Length = 1650 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +1 Query: 139 EKENEVRALRAFQADCAEDVQVKPDLV 219 E ENE RALR+F+ D D Q P ++ Sbjct: 986 EAENEDRALRSFKMDVKVDRQYHPKII 1012 >SB_19734| Best HMM Match : RNA_pol_Rpb1_5 (HMM E-Value=0) Length = 1452 Score = 28.3 bits (60), Expect = 7.0 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = +1 Query: 139 EKENEVRALRAFQADCAEDVQVKPDLVVNLKSGDWQTEDVSLKKW 273 +K+N A AF+AD E+VQ K D V K G + + K W Sbjct: 458 DKQNRTSAFLAFEADNLEEVQGKHDTVPE-KFGRSKAQLELFKMW 501 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,191,658 Number of Sequences: 59808 Number of extensions: 453017 Number of successful extensions: 1137 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1068 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1137 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -