BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10g11 (546 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 30 0.018 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 27 0.16 AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 26 0.29 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 25 0.38 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 25 0.66 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 24 0.88 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 23 1.5 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 2.0 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 2.0 DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. 22 3.5 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 22 4.7 D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. 21 6.2 AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly pro... 21 6.2 AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly pro... 21 6.2 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 21 8.2 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 29.9 bits (64), Expect = 0.018 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -2 Query: 383 DGHSIYGKSFSHSYTSWRECEGKVQLYLL*VSKPGEVWIL 264 DG+ + + SY + C+G +Y + V K G +WIL Sbjct: 98 DGNPLIAPYPNWSYNDVKYCDGLTSVYRMQVDKCGRLWIL 137 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 26.6 bits (56), Expect = 0.16 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +2 Query: 134 SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL 244 +DT+ K KI K I PD + L+ KQ E G TL Sbjct: 732 TDTVLAYKPKILGKPTISPDSRHLVTLDKQ-ETGVTL 767 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 25.8 bits (54), Expect = 0.29 Identities = 9/28 (32%), Positives = 17/28 (60%) Frame = -2 Query: 347 SYTSWRECEGKVQLYLL*VSKPGEVWIL 264 S+ ++++C G V Y + + K +WIL Sbjct: 115 SWANYKDCSGIVSAYKIAIDKFDRLWIL 142 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 25.4 bits (53), Expect = 0.38 Identities = 8/28 (28%), Positives = 17/28 (60%) Frame = -2 Query: 347 SYTSWRECEGKVQLYLL*VSKPGEVWIL 264 S+ ++++C G V Y + + K +W+L Sbjct: 115 SWANYKDCSGIVSAYKIAIDKFDRLWVL 142 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 24.6 bits (51), Expect = 0.66 Identities = 17/70 (24%), Positives = 33/70 (47%), Gaps = 6/70 (8%) Frame = -3 Query: 469 YLILDLLFGSQIVSV----SALC--LATVGSTRMKTGIAFTANHFLTVILHGENAKGRFN 308 +L+ LFG Q +++ +AL + G + +G + ++ T+I + G N Sbjct: 7 WLLSICLFGLQEIAIQPGSNALSRNVEASGQRSVSSGFRSSLRNYKTLISSHDELPGHIN 66 Query: 307 CTSSKSQNQV 278 C SSK + + Sbjct: 67 CDSSKFEEDL 76 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 24.2 bits (50), Expect = 0.88 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = +1 Query: 130 SFRHYRKCQS*NPRQGRYSSRPTTSHLCRETIRRWPHS 243 S +H KC + +SS P +H CR W HS Sbjct: 162 SVKHVAKCAT------DFSSWPYDTHRCRINFGSWVHS 193 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 23.4 bits (48), Expect = 1.5 Identities = 8/28 (28%), Positives = 15/28 (53%) Frame = -2 Query: 347 SYTSWRECEGKVQLYLL*VSKPGEVWIL 264 S+ + +C G V + + V K +W+L Sbjct: 117 SFAKYEDCSGIVSAFKIAVDKFDRLWVL 144 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 23.0 bits (47), Expect = 2.0 Identities = 16/68 (23%), Positives = 27/68 (39%) Frame = +2 Query: 128 EASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGT 307 ++ DT E K +Q KEG Q+ F G L + + T+ ++ G Sbjct: 931 KSQDTTEVTKYILQYKEGDAGIWQQQEFTGPPLPYAALIDELKPATRYTIRVIAEGPAGR 990 Query: 308 IEPSLRIL 331 PS ++ Sbjct: 991 SVPSAELI 998 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 23.0 bits (47), Expect = 2.0 Identities = 16/68 (23%), Positives = 27/68 (39%) Frame = +2 Query: 128 EASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGT 307 ++ DT E K +Q KEG Q+ F G L + + T+ ++ G Sbjct: 927 KSQDTTEVTKYILQYKEGDAGIWQQQEFTGPPLPYAALIDELKPATRYTIRVIAEGPAGR 986 Query: 308 IEPSLRIL 331 PS ++ Sbjct: 987 SVPSAELI 994 >DQ288391-1|ABC41341.1| 630|Apis mellifera vasa protein protein. Length = 630 Score = 22.2 bits (45), Expect = 3.5 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -3 Query: 100 KGFDEYLHCVAKINHT*NL*LFTS*LDRE 14 KG DEY+H + + N TS D E Sbjct: 530 KGIDEYVHRIGRTGRVGNRGRATSFFDPE 558 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.8 bits (44), Expect = 4.7 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = -2 Query: 335 WRECEGKVQLYLL 297 W++CEGK+ YL+ Sbjct: 200 WKQCEGKID-YLV 211 >D79207-1|BAA23639.1| 432|Apis mellifera milk protein protein. Length = 432 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/28 (28%), Positives = 14/28 (50%) Frame = -2 Query: 347 SYTSWRECEGKVQLYLL*VSKPGEVWIL 264 S+ + +C G V L + K +W+L Sbjct: 111 SFAKYDDCSGIVSASKLAIDKCDRLWVL 138 >AF388203-1|AAM73637.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/28 (28%), Positives = 14/28 (50%) Frame = -2 Query: 347 SYTSWRECEGKVQLYLL*VSKPGEVWIL 264 S+ + +C G V L + K +W+L Sbjct: 111 SFAKYDDCSGIVSASKLAIDKCDRLWVL 138 >AF000633-1|AAC61895.1| 432|Apis mellifera major royal jelly protein MRJP1 protein. Length = 432 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/28 (28%), Positives = 14/28 (50%) Frame = -2 Query: 347 SYTSWRECEGKVQLYLL*VSKPGEVWIL 264 S+ + +C G V L + K +W+L Sbjct: 111 SFAKYDDCSGIVSASKLAIDKCDRLWVL 138 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 21.0 bits (42), Expect = 8.2 Identities = 6/28 (21%), Positives = 15/28 (53%) Frame = -2 Query: 347 SYTSWRECEGKVQLYLL*VSKPGEVWIL 264 S+ + +C G V + + + + +W+L Sbjct: 116 SFAKYEDCSGIVSAHKIAIDEYERLWVL 143 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,348 Number of Sequences: 438 Number of extensions: 3215 Number of successful extensions: 16 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15581757 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -