BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10g08 (655 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22859| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_40264| Best HMM Match : DUF667 (HMM E-Value=0) 29 3.3 SB_13951| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_22404| Best HMM Match : SNF2_N (HMM E-Value=0) 28 5.8 SB_9261| Best HMM Match : Chitin_synth_2 (HMM E-Value=2.7e-07) 28 5.8 SB_33107| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_46944| Best HMM Match : Myc-LZ (HMM E-Value=9.2) 28 7.6 SB_12619| Best HMM Match : DUF837 (HMM E-Value=4.9) 28 7.6 SB_52587| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2) 28 7.6 SB_52548| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.6 SB_50379| Best HMM Match : Myc-LZ (HMM E-Value=9.2) 28 7.6 SB_7558| Best HMM Match : TPR_MLP1_2 (HMM E-Value=2.2) 28 7.6 >SB_22859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1108 Score = 29.5 bits (63), Expect = 2.5 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = -1 Query: 463 FVQIFFVDSSNSFFQFGHVVLVREPHQV*SH-VLLQPRTDVRVGKGI 326 F+++FF D S F H LV E + H V+++P+ VRVG + Sbjct: 529 FIRVFFADFSKGFDLVDHNALVNEMKLLNVHNVIIRPQR-VRVGNAL 574 >SB_40264| Best HMM Match : DUF667 (HMM E-Value=0) Length = 2074 Score = 29.1 bits (62), Expect = 3.3 Identities = 17/60 (28%), Positives = 28/60 (46%) Frame = +2 Query: 251 EMSRKKMKRFQLPNLPRWWQAKVIQYAFAHPHVRARLEKHMGSNLVRLTDKNYMTELEER 430 E+S +KMK + + + +++ HP A +E M + VR +K Y T L R Sbjct: 1786 ELSEEKMKEYMKALKTKKFSK--LEFCLRHPFTIALVEGEMSAEEVRKYEKRYETALASR 1843 >SB_13951| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 29.1 bits (62), Expect = 3.3 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +2 Query: 344 HVRARLEKHMGSNLVRLTD 400 H++ARL KH G NL+ TD Sbjct: 338 HLKARLVKHFGENLISSTD 356 >SB_22404| Best HMM Match : SNF2_N (HMM E-Value=0) Length = 1918 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/66 (22%), Positives = 34/66 (51%) Frame = +2 Query: 344 HVRARLEKHMGSNLVRLTDKNYMTELEERIRAVNEENLNKRISSRVLDEMERLKRLILVG 523 H ++ H G +++ + D ++ ++ E + A E + KR++ + + +RL V Sbjct: 327 HAKSLSYVHKGQSVMSVLDNSFGSQEEIVVEAKKEAEVIKRVNELRKEGLWSTRRLPKVQ 386 Query: 524 KTPLKE 541 +TP K+ Sbjct: 387 ETPRKK 392 >SB_9261| Best HMM Match : Chitin_synth_2 (HMM E-Value=2.7e-07) Length = 2435 Score = 28.3 bits (60), Expect = 5.8 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +2 Query: 443 NEENLNKRISSRVLDEMERLKRLILVGKTPLKECPPE 553 N+ENL+++ S + D E +K L+ + + CPPE Sbjct: 435 NKENLSRKKSKSLDDIHEEIKFEQLIRRARSESCPPE 471 >SB_33107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1079 Score = 28.3 bits (60), Expect = 5.8 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -3 Query: 371 CASPAAHGRAGGQRHIVSLLPAT 303 C SP GRAG + + S+LP+T Sbjct: 589 CISPRVKGRAGHKEKVFSVLPST 611 >SB_46944| Best HMM Match : Myc-LZ (HMM E-Value=9.2) Length = 76 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 353 ARLEKHMGSNLVRLTDKNYMTELEERIRAVNEENLNKR 466 A++ K MGSN+ + +N + + +RIR ++N KR Sbjct: 29 AQVHKFMGSNMREKSQRNQLLKKLKRIRNRYKDNTRKR 66 >SB_12619| Best HMM Match : DUF837 (HMM E-Value=4.9) Length = 192 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 353 ARLEKHMGSNLVRLTDKNYMTELEERIRAVNEENLNKR 466 A++ K MGSN+ + +N + + +RIR ++N KR Sbjct: 145 AQVHKFMGSNMREKSQRNQLLKKLKRIRNRYKDNTRKR 182 >SB_52587| Best HMM Match : Pox_A_type_inc (HMM E-Value=3.2) Length = 237 Score = 27.9 bits (59), Expect = 7.6 Identities = 21/104 (20%), Positives = 40/104 (38%) Frame = +2 Query: 224 EGEDETGEGEMSRKKMKRFQLPNLPRWWQAKVIQYAFAHPHVRARLEKHMGSNLVRLTDK 403 E E E E+ + + Q+ RWW + VRA K N R Sbjct: 39 EARQELKERELEEARARAAQMEKTMRWWSDCTANWREKWGKVRAERNKAREDN--RQLKL 96 Query: 404 NYMTELEERIRAVNEENLNKRISSRVLDEMERLKRLILVGKTPL 535 + ++ + E +++R+ ++++L+R + GK L Sbjct: 97 KIEAQAKDIVTLKRERQEALEVNARLERDIDKLERELKRGKRVL 140 >SB_52548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 353 ARLEKHMGSNLVRLTDKNYMTELEERIRAVNEENLNKR 466 A++ K MGSN+ + +N + + +RIR ++N KR Sbjct: 23 AQVHKFMGSNMREKSQRNQLLKKLKRIRNRYKDNTRKR 60 >SB_50379| Best HMM Match : Myc-LZ (HMM E-Value=9.2) Length = 77 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 353 ARLEKHMGSNLVRLTDKNYMTELEERIRAVNEENLNKR 466 A++ K MGSN+ + +N + + +RIR ++N KR Sbjct: 30 AQVHKFMGSNMREKSQRNQLLKKLKRIRNRYKDNTRKR 67 >SB_7558| Best HMM Match : TPR_MLP1_2 (HMM E-Value=2.2) Length = 299 Score = 27.9 bits (59), Expect = 7.6 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = +2 Query: 353 ARLEKHMGSNLVRLTDKNYMTELEERIRAVNEENLNKR 466 A++ K MGSN+ + +N + + +RIR ++N KR Sbjct: 252 AQVHKFMGSNMREKSQRNQLLKKLKRIRNRYKDNTRKR 289 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,750,988 Number of Sequences: 59808 Number of extensions: 350104 Number of successful extensions: 882 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 842 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 881 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1669334250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -