BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10g03 (541 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 26 0.93 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 24 2.8 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 24 2.8 AF026493-1|AAB81851.1| 112|Anopheles gambiae chitinase protein. 23 6.5 Y17704-1|CAA76824.2| 401|Anopheles gambiae hypothetical protein... 23 8.7 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 8.7 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 8.7 AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltr... 23 8.7 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 25.8 bits (54), Expect = 0.93 Identities = 7/38 (18%), Positives = 25/38 (65%) Frame = +3 Query: 198 NGVTAADITKYLQEKFGDVWKVSALVGKAEETLKRSAQ 311 +G+ ++ L++++GD++++ A +G+A+ + + + Sbjct: 62 DGLNLIELHIRLRQEYGDIYRIPAAMGRADVVMSSAPE 99 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 24.2 bits (50), Expect = 2.8 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 3 STSKITILTVSLIGFHVFFFVIQHLI 80 S K+T+ LI HVFF ++ +I Sbjct: 271 SGEKVTLSISILISLHVFFLLVVEII 296 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 24.2 bits (50), Expect = 2.8 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 3 STSKITILTVSLIGFHVFFFVIQHLI 80 S K+T+ LI HVFF ++ +I Sbjct: 271 SGEKVTLSISILISLHVFFLLVVEII 296 >AF026493-1|AAB81851.1| 112|Anopheles gambiae chitinase protein. Length = 112 Score = 23.0 bits (47), Expect = 6.5 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = -3 Query: 101 CNNILYIYQMLDYKKKNMKTN 39 C +I+Y + +LDY +KT+ Sbjct: 21 CTHIVYGFAVLDYSTLTIKTH 41 >Y17704-1|CAA76824.2| 401|Anopheles gambiae hypothetical protein protein. Length = 401 Score = 22.6 bits (46), Expect = 8.7 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +3 Query: 285 EETLKRSAQLGFLDKRGERYISK 353 E+T K SA+L L K E+++SK Sbjct: 346 EQTGKSSAELVRLKKLEEKFVSK 368 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 22.6 bits (46), Expect = 8.7 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +2 Query: 293 FEEECTAWLLG 325 FEE+CT W+ G Sbjct: 2378 FEEKCTRWIEG 2388 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 22.6 bits (46), Expect = 8.7 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +2 Query: 293 FEEECTAWLLG 325 FEE+CT W+ G Sbjct: 2388 FEEKCTRWIEG 2398 >AJ821850-1|CAH25390.1| 426|Anopheles gambiae alpha-2,6-sialyltransferase protein. Length = 426 Score = 22.6 bits (46), Expect = 8.7 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +3 Query: 243 FGDVWKVSALVGKAEETLKRSAQLGFLDK 329 FGDV S ++ + +LKRS F+D+ Sbjct: 195 FGDVTNGSCVIVASAGSLKRSQLGSFIDE 223 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 515,652 Number of Sequences: 2352 Number of extensions: 9982 Number of successful extensions: 52 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 52 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 52 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 50320221 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -