BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10g03 (541 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z66567-2|CAA91488.1| 1118|Caenorhabditis elegans Hypothetical pr... 29 2.8 U58751-11|AAB00662.1| 265|Caenorhabditis elegans Trypsin-like p... 27 6.5 >Z66567-2|CAA91488.1| 1118|Caenorhabditis elegans Hypothetical protein ZK455.2 protein. Length = 1118 Score = 28.7 bits (61), Expect = 2.8 Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +2 Query: 200 WRDGGGYNEIFTGK-IWRRMESKRF 271 + DGGGYN G IW RM +++F Sbjct: 376 FEDGGGYNVHMNGSLIWSRMTNRQF 400 >U58751-11|AAB00662.1| 265|Caenorhabditis elegans Trypsin-like protease protein 2 protein. Length = 265 Score = 27.5 bits (58), Expect = 6.5 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -2 Query: 444 FDCSHNDGAYVCRVVFAYTDVCASRIYHGLF 352 F C DGA+V V ++ D CA + G++ Sbjct: 216 FACRREDGAFVLAGVISWGDGCAQKKQPGIY 246 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,403,948 Number of Sequences: 27780 Number of extensions: 218201 Number of successful extensions: 664 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 640 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 664 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1081316076 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -