BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10g01 (769 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 23 2.7 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 23 3.6 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 22 4.7 AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like pr... 22 6.2 Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor ... 21 8.2 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 23.0 bits (47), Expect = 2.7 Identities = 7/28 (25%), Positives = 18/28 (64%) Frame = +1 Query: 658 ESSHDLCESLKIDYDDQTNEWLNEVKPN 741 ++S+ C++L+ +D+Q + ++ PN Sbjct: 203 DNSYQFCDNLQYSFDNQCSGTIDWALPN 230 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 22.6 bits (46), Expect = 3.6 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = +1 Query: 583 LELNCDSAAAYKFRG--RAYRLLGKFEESSHD 672 L L CDSA + + Y+L+ KF E SH+ Sbjct: 291 LVLICDSAKSESQQTVFLCYKLMEKFPERSHE 322 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 22.2 bits (45), Expect = 4.7 Identities = 7/30 (23%), Positives = 18/30 (60%) Frame = +1 Query: 658 ESSHDLCESLKIDYDDQTNEWLNEVKPNAE 747 ++S+ C++L+ +D+Q + ++ P E Sbjct: 194 DNSYQFCDNLQYSFDNQCSGTIDWALPKQE 223 >AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like protein protein. Length = 242 Score = 21.8 bits (44), Expect = 6.2 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 341 TNLKTWVIQTRRSLKKK 391 T + TW RR LKK+ Sbjct: 129 TQVSTWFANARRRLKKE 145 >Z69735-1|CAA93623.1| 162|Tribolium castaneum initiation factor 5-like protein protein. Length = 162 Score = 21.4 bits (43), Expect = 8.2 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +1 Query: 679 ESLKIDYDDQTNEWLNEVKPNAEKLRQHKL 768 E+ K DD+ +EW +V A + R L Sbjct: 107 ENSKNGDDDEGHEWQADVSEEAVRARMQDL 136 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,390 Number of Sequences: 336 Number of extensions: 3465 Number of successful extensions: 14 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20650031 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -