BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10f24 (507 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL117204-35|CAB55154.2| 861|Caenorhabditis elegans Hypothetical... 27 5.9 U00041-1|AAA50671.3| 2248|Caenorhabditis elegans Abnormal cell l... 27 7.8 AF245435-1|AAF87497.1| 2248|Caenorhabditis elegans zinc finger p... 27 7.8 >AL117204-35|CAB55154.2| 861|Caenorhabditis elegans Hypothetical protein Y116A8C.14 protein. Length = 861 Score = 27.5 bits (58), Expect = 5.9 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = -2 Query: 401 VWNIC-KKYNDKKNFFSYLNVVIIHK*SSIKTIDFFILINTK*NGPLITKIN 249 +W KK+N+K++F+ +++ ++ SI + FF N K + P T N Sbjct: 792 IWKFLRKKFNNKRSFYVFISAIVFSILLSILLVVFF--GNVKIDCPWCTHFN 841 >U00041-1|AAA50671.3| 2248|Caenorhabditis elegans Abnormal cell lineage protein 13 protein. Length = 2248 Score = 27.1 bits (57), Expect = 7.8 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 Query: 371 CHYIFYKCSKHKCLSCKVTNMSL 439 C+YIF K CLSC+VT L Sbjct: 776 CNYIFSKDPVVHCLSCEVTEDDL 798 >AF245435-1|AAF87497.1| 2248|Caenorhabditis elegans zinc finger protein LIN-13 protein. Length = 2248 Score = 27.1 bits (57), Expect = 7.8 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +2 Query: 371 CHYIFYKCSKHKCLSCKVTNMSL 439 C+YIF K CLSC+VT L Sbjct: 776 CNYIFSKDPVVHCLSCEVTEDDL 798 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,428,703 Number of Sequences: 27780 Number of extensions: 226849 Number of successful extensions: 446 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 425 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 445 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 977860456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -