BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10f22 (522 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8... 25 2.0 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 24 2.7 AY750997-1|AAV31069.1| 153|Anopheles gambiae peritrophin-1 prot... 23 4.7 AY344823-1|AAR02434.1| 153|Anopheles gambiae peritrophin A prot... 23 4.7 AJ439060-9|CAD27760.1| 348|Anopheles gambiae putative translati... 23 8.2 >AJ459961-1|CAD31060.1| 700|Anopheles gambiae prophenoloxidase 8 protein. Length = 700 Score = 24.6 bits (51), Expect = 2.0 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +3 Query: 309 PERRSSD-EYGRRARVELRSASWHRGLQELWRLFAVVVRMLGNVGDRPLN 455 P RR+ + RRA +RS + + RL V +R + + DRP N Sbjct: 651 PSRRAMGFPFDRRASNGVRSVADFVAPYKNMRLATVTLRFMNTIIDRPTN 700 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 24.2 bits (50), Expect = 2.7 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -2 Query: 431 PQHPNHDSEQPPELLKAA 378 P P H EQPP+++ AA Sbjct: 918 PPPPTHRLEQPPQVVAAA 935 >AY750997-1|AAV31069.1| 153|Anopheles gambiae peritrophin-1 protein. Length = 153 Score = 23.4 bits (48), Expect = 4.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -2 Query: 443 VADIPQHPNHDSEQPPELL 387 +AD+ P D EQPP LL Sbjct: 16 LADVRCPPQDDPEQPPVLL 34 >AY344823-1|AAR02434.1| 153|Anopheles gambiae peritrophin A protein. Length = 153 Score = 23.4 bits (48), Expect = 4.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -2 Query: 443 VADIPQHPNHDSEQPPELL 387 +AD+ P D EQPP LL Sbjct: 16 LADVRCPPQDDPEQPPVLL 34 >AJ439060-9|CAD27760.1| 348|Anopheles gambiae putative translation initiation factor protein. Length = 348 Score = 22.6 bits (46), Expect = 8.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +3 Query: 441 DRPLNIVTRCSNG 479 DRPL ++T C+ G Sbjct: 152 DRPLKLLTHCNTG 164 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 507,891 Number of Sequences: 2352 Number of extensions: 8544 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -