BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10f22 (522 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY118726-1|AAM50586.1| 448|Drosophila melanogaster GH02222p pro... 28 8.8 >AY118726-1|AAM50586.1| 448|Drosophila melanogaster GH02222p protein. Length = 448 Score = 27.9 bits (59), Expect = 8.8 Identities = 16/46 (34%), Positives = 18/46 (39%), Gaps = 1/46 (2%) Frame = +1 Query: 313 SDAPLTSMDVERALSFAPRRGTAAFKSSGGCSLSWFG-CWGMSATG 447 SD S L+ P R TAA + S C W G W S G Sbjct: 362 SDCDRVSSAPAEILARTPARATAAHRFSAKCLAKWIGTSWWASCPG 407 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,115,441 Number of Sequences: 53049 Number of extensions: 399816 Number of successful extensions: 1534 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1532 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 1929233664 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -