BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10f20 (718 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB096966-1|BAD23801.1| 112|Homo sapiens uromodulin-like 1 prote... 30 7.2 BC028703-1|AAH28703.1| 383|Homo sapiens LASS3 protein protein. 30 9.5 >AB096966-1|BAD23801.1| 112|Homo sapiens uromodulin-like 1 protein variant 2 protein. Length = 112 Score = 30.3 bits (65), Expect = 7.2 Identities = 14/55 (25%), Positives = 26/55 (47%) Frame = +3 Query: 537 VENSENKVLGLRSLVHESLAQPHGLSVKKPHGACSCMMKSPTSFNHQTDPTKICT 701 ++ + ++L L+H + + G + P G+CS +SP N P+ CT Sbjct: 19 LQQVDPRLLNHMRLLHSLVGETDGGCLHPPCGSCSGRPRSPAPCNQWPPPSTTCT 73 >BC028703-1|AAH28703.1| 383|Homo sapiens LASS3 protein protein. Length = 383 Score = 29.9 bits (64), Expect = 9.5 Identities = 28/81 (34%), Positives = 39/81 (48%), Gaps = 1/81 (1%) Frame = -1 Query: 562 NTLFSEFSTKVFPTRL-VSP*ESLFCWLSFSLLPELARNSITGHFCFNSNVGVGILALFH 386 NTLF FST F +RL V P L+C L +LP + N+ + IL + H Sbjct: 261 NTLFFIFSTIFFISRLIVFPFWILYCTL---ILPMYHLEPFFSYIFL--NLQLMILQVLH 315 Query: 385 VRIEGLYVMSFS*DCCFIESI 323 R G Y++ C F++SI Sbjct: 316 -RYWGYYILKMLNRCIFMKSI 335 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,969,177 Number of Sequences: 237096 Number of extensions: 1938723 Number of successful extensions: 3723 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3581 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3723 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8399192100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -