BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10f19 (413 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_9764| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-05) 29 1.1 SB_7583| Best HMM Match : PT (HMM E-Value=6.1) 29 2.0 SB_47366| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.6 SB_53038| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.6 SB_45168| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.1 SB_27857| Best HMM Match : Cadherin (HMM E-Value=0) 27 8.1 >SB_9764| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-05) Length = 434 Score = 29.5 bits (63), Expect = 1.1 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 3/71 (4%) Frame = +3 Query: 63 VFGKVQGVF--FRKFTQKKALELGLKGWVMNTAQGTVIG-QLQGPSTAVDDMKLWLQKVG 233 VF + VF FR FT+ A +L + W++ V+ ++ S +DD +G Sbjct: 192 VFDRYMAVFHPFRTFTRAFAKKLVIAAWIVGAILAVVLTLPIKNMSIELDDNVYTFSCIG 251 Query: 234 SPKSKIEKAAF 266 S EK F Sbjct: 252 SSNEVWEKVVF 262 >SB_7583| Best HMM Match : PT (HMM E-Value=6.1) Length = 501 Score = 28.7 bits (61), Expect = 2.0 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 1/42 (2%) Frame = -1 Query: 185 SLKLTYNSSLRRIHY-PSLKSKF*CFLLRKLPEEYSLHFSKN 63 S+K ++S+ RRI PS+ S + C L R +P E H +K+ Sbjct: 459 SIKEIHDSTHRRIRSNPSMASPYHCCLSRGIPREVRSHENKH 500 >SB_47366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 28.3 bits (60), Expect = 2.6 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = +3 Query: 156 QGTVIGQLQGPSTAVDDMKLWLQKVGSPKSKIEKAAFRNEGN 281 +GT IGQ++GP A D + W+ +I+ F +EGN Sbjct: 298 KGTGIGQMKGPCGAAVDGENWVLVADRDNHRIQ--VFDSEGN 337 >SB_53038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 27.5 bits (58), Expect = 4.6 Identities = 10/22 (45%), Positives = 17/22 (77%) Frame = -2 Query: 133 LSPSSNAFFCVNFLKNTPCTFP 68 LSPS +A CV+++++T C+ P Sbjct: 20 LSPSGDASGCVDYIRSTHCSGP 41 >SB_45168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 478 Score = 27.1 bits (57), Expect = 6.1 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -2 Query: 322 HLRISNVLKAQHLIFPSFLNAAFSILDFGLP 230 H+R + +LI P FL AF++L F LP Sbjct: 123 HIRRKVLFYFNNLIVPCFLITAFALLTFVLP 153 >SB_27857| Best HMM Match : Cadherin (HMM E-Value=0) Length = 2418 Score = 26.6 bits (56), Expect = 8.1 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +1 Query: 181 KDPRLLLMT*SFGYKRSEAQNLRSRKRRSGMREILNAAL 297 KD L SF Y+ + NLR R S ++E+ +A+L Sbjct: 738 KDSGRLHTKNSFNYENVDRYNLRIEARTSSVQEVASASL 776 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,397,699 Number of Sequences: 59808 Number of extensions: 206848 Number of successful extensions: 460 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 439 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 460 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 764823134 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -