BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10f19 (413 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. 23 4.4 AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsiv... 23 5.8 >DQ314781-1|ABC54566.1| 407|Anopheles gambiae OSKAR protein. Length = 407 Score = 23.0 bits (47), Expect = 4.4 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +2 Query: 353 RTSLVHLLLTINKYIC 400 RT++ LL +N+YIC Sbjct: 321 RTTMAERLLKLNEYIC 336 >AY496421-1|AAS80138.1| 439|Anopheles gambiae bacteria responsive protein 2 protein. Length = 439 Score = 22.6 bits (46), Expect = 5.8 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +3 Query: 165 VIGQLQGPS-TAVDDMKLWLQKVGSPKSKIEKAAFR 269 V L PS TA+ L+KVG P + AFR Sbjct: 340 VCAMLPNPSNTALKGADAPLRKVGDPTKRFGSYAFR 375 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 390,399 Number of Sequences: 2352 Number of extensions: 6284 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 33777477 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -