BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10f19 (413 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U00025-1|ABA54413.1| 589|Caenorhabditis elegans Amp-activated k... 29 1.8 AY347272-1|AAR06927.1| 589|Caenorhabditis elegans AMP-activated... 29 1.8 U40417-1|AAA81411.1| 114|Caenorhabditis elegans Hypothetical pr... 27 7.1 U10402-11|AAA19063.2| 434|Caenorhabditis elegans Gro-1 operon g... 27 7.1 AY052771-1|AAL14110.1| 434|Caenorhabditis elegans GOP-3 protein. 27 7.1 AC006747-5|AAF60510.3| 310|Caenorhabditis elegans Hypothetical ... 26 9.4 >U00025-1|ABA54413.1| 589|Caenorhabditis elegans Amp-activated kinase protein 1,isoform a protein. Length = 589 Score = 28.7 bits (61), Expect = 1.8 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = -2 Query: 328 YNHLRISNVLKAQHLIFPSFLNAAFSILDFGLPTFCNQSFMSSTAVEGP 182 +NH+ + LK ++L+ + N I DFGL + + STA P Sbjct: 139 HNHMIVHRDLKPENLLLDA--NKNIKIADFGLSNYMTDGDLLSTACGSP 185 >AY347272-1|AAR06927.1| 589|Caenorhabditis elegans AMP-activated protein kinase alphasubunit 2 protein. Length = 589 Score = 28.7 bits (61), Expect = 1.8 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = -2 Query: 328 YNHLRISNVLKAQHLIFPSFLNAAFSILDFGLPTFCNQSFMSSTAVEGP 182 +NH+ + LK ++L+ + N I DFGL + + STA P Sbjct: 139 HNHMIVHRDLKPENLLLDA--NKNIKIADFGLSNYMTDGDLLSTACGSP 185 >U40417-1|AAA81411.1| 114|Caenorhabditis elegans Hypothetical protein T08A9.6 protein. Length = 114 Score = 26.6 bits (56), Expect = 7.1 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 109 FCVNFLKNTPCTFPKTSKSAV 47 FC N KN P TF TSK AV Sbjct: 79 FCNNGQKNRPLTFNFTSKRAV 99 >U10402-11|AAA19063.2| 434|Caenorhabditis elegans Gro-1 operon gene protein 3 protein. Length = 434 Score = 26.6 bits (56), Expect = 7.1 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -2 Query: 130 SPSSNAFFCVNFLKNTPCTFPKTSKSAVT 44 SPSSN + VNFL P +F K+ V+ Sbjct: 82 SPSSNEGYVVNFLVREPKSFTAGVKAGVS 110 >AY052771-1|AAL14110.1| 434|Caenorhabditis elegans GOP-3 protein. Length = 434 Score = 26.6 bits (56), Expect = 7.1 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -2 Query: 130 SPSSNAFFCVNFLKNTPCTFPKTSKSAVT 44 SPSSN + VNFL P +F K+ V+ Sbjct: 82 SPSSNEGYVVNFLVREPKSFTAGVKAGVS 110 >AC006747-5|AAF60510.3| 310|Caenorhabditis elegans Hypothetical protein Y39A3A.3 protein. Length = 310 Score = 26.2 bits (55), Expect = 9.4 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +3 Query: 201 DDMKLWLQKVGSPKSKIEKAAFRNEGNIKCCA 296 D ++++ +K G+ IE +GNIK C+ Sbjct: 77 DGLEIFCRKFGTSSLSIEMDPLNTDGNIKYCS 108 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,769,670 Number of Sequences: 27780 Number of extensions: 165820 Number of successful extensions: 392 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 385 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 392 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 673122114 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -