BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10f19 (413 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g03370.1 68418.m00290 acylphosphatase family contains Pfam PF... 54 5e-08 At2g27770.1 68415.m03365 expressed protein 30 0.71 At1g37020.1 68414.m04616 Ulp1 protease family protein 29 0.94 At2g37930.1 68415.m04656 expressed protein 28 2.9 At5g16010.1 68418.m01872 3-oxo-5-alpha-steroid 4-dehydrogenase f... 26 8.7 >At5g03370.1 68418.m00290 acylphosphatase family contains Pfam PF00708: Acylphosphatase Length = 171 Score = 53.6 bits (123), Expect = 5e-08 Identities = 25/57 (43%), Positives = 35/57 (61%) Frame = +3 Query: 39 NSVTADFEVFGKVQGVFFRKFTQKKALELGLKGWVMNTAQGTVIGQLQGPSTAVDDM 209 +S T + G+VQGV +R +T + A +LG+KGWV N G+V GP AVD+M Sbjct: 80 SSKTVRVVIKGRVQGVCYRNWTVENAEQLGIKGWVRNRRDGSVEALFSGPPEAVDEM 136 >At2g27770.1 68415.m03365 expressed protein Length = 320 Score = 29.9 bits (64), Expect = 0.71 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -2 Query: 154 AVFITHPLSPSSNAFFCVNFLKNTPCTFPKTSKSAVTLFT 35 ++ +THPLS SS++ C + N C P S T T Sbjct: 12 SINVTHPLSISSSSSSCSKYSTNNVCISPSLIPSIQTSIT 51 >At1g37020.1 68414.m04616 Ulp1 protease family protein Length = 611 Score = 29.5 bits (63), Expect = 0.94 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = -1 Query: 110 LLRKLPEEYSLHFSKNFEIRRYTIYFVH 27 L+RK+ +Y+ H+S +F+ +T Y+V+ Sbjct: 410 LIRKMKNDYNKHYSSDFKTYNWTGYYVN 437 >At2g37930.1 68415.m04656 expressed protein Length = 467 Score = 27.9 bits (59), Expect = 2.9 Identities = 19/58 (32%), Positives = 28/58 (48%) Frame = -2 Query: 220 NQSFMSSTAVEGP*S*PITVPCAVFITHPLSPSSNAFFCVNFLKNTPCTFPKTSKSAV 47 + S +SST+ S P+T +V+ TH SN N ++ P PKT K+ V Sbjct: 130 SSSSLSSTSHASAKSGPLTFTNSVYTTHSTRTKSNGH---NRTRSGPILKPKTEKNNV 184 >At5g16010.1 68418.m01872 3-oxo-5-alpha-steroid 4-dehydrogenase family protein / steroid 5-alpha-reductase family protein similar to steroid 5alpha-reductase - Rattus norvegicus, PIR:A34239 [SP|24008]; contains Pfam 3-oxo-5-alpha-steroid 4-dehydrogenase domain PF02544 Length = 268 Score = 26.2 bits (55), Expect = 8.7 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = -1 Query: 311 FKCPKSAAFNISLIPERRFLDLRFWASDLL*PKLHVINSSRGSL 180 +K PK F+I + P F L FW+ L+ ++ + + G++ Sbjct: 192 YKIPKGGLFDIIICPHYLFEILVFWSFFLISQTIYSFSFAMGTM 235 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,139,748 Number of Sequences: 28952 Number of extensions: 152811 Number of successful extensions: 373 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 373 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 373 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 625471056 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -