BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10f17 (598 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 24 0.98 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 23 1.7 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 1.7 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 22 5.3 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 22 5.3 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 24.2 bits (50), Expect = 0.98 Identities = 11/39 (28%), Positives = 22/39 (56%) Frame = +1 Query: 169 YEELITVLTQIEAILNSRPLTPLSSDPDDMMPLTPGHFL 285 +E+ +T+ E I+N + LT + ++ + + PGH L Sbjct: 33 FEDRVTMYVY-EEIINGKKLTEIINETHENVKYLPGHKL 70 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 23.4 bits (48), Expect = 1.7 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 28 LPDALIEEGINFHLCPPYSPHFGGLWE 108 +PD + EEG ++ PP F LW+ Sbjct: 49 MPDYIFEEGDDYVTLPP--EFFDSLWQ 73 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.4 bits (48), Expect = 1.7 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 558 SVGPWIDXYYAAQSPFKWRE 499 ++GP+I AA +PFK E Sbjct: 759 NIGPYIQKMIAAAAPFKGME 778 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.8 bits (44), Expect = 5.3 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +1 Query: 223 PLTPLSSDPDDMMPLTPGHF 282 P +PL PD + PG+F Sbjct: 44 PQSPLDMKPDTASLINPGNF 63 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.8 bits (44), Expect = 5.3 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +1 Query: 223 PLTPLSSDPDDMMPLTPGHF 282 P +PL PD + PG+F Sbjct: 44 PQSPLDMKPDTASLINPGNF 63 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 169,804 Number of Sequences: 438 Number of extensions: 3640 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -