BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10f15 (501 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 24 0.88 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 24 0.88 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 24 0.88 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 24 0.88 DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped prot... 21 8.2 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 23.8 bits (49), Expect = 0.88 Identities = 14/67 (20%), Positives = 30/67 (44%) Frame = +2 Query: 191 RKCSLILTKILYLLNQGENFTTQEATDAFFATTKLFQSKEIMLRRMVYLCIKELSKLAQD 370 +KC I KIL ++ F + T LF + ++ ++ C ++L + Q Sbjct: 60 QKCLEITVKILKIVAYLVTFVIVLGSGVISKGTLLFMTSQLKPDKVTVFCNRDLGREKQF 119 Query: 371 VIIVTSS 391 ++ + S+ Sbjct: 120 IVKLPSA 126 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 23.8 bits (49), Expect = 0.88 Identities = 14/67 (20%), Positives = 30/67 (44%) Frame = +2 Query: 191 RKCSLILTKILYLLNQGENFTTQEATDAFFATTKLFQSKEIMLRRMVYLCIKELSKLAQD 370 +KC I KIL ++ F + T LF + ++ ++ C ++L + Q Sbjct: 60 QKCLEITVKILKIVAYLVTFVIVLGSGVISKGTLLFMTSQLKPDKVTVFCNRDLGREKQF 119 Query: 371 VIIVTSS 391 ++ + S+ Sbjct: 120 IVKLPSA 126 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 23.8 bits (49), Expect = 0.88 Identities = 14/67 (20%), Positives = 30/67 (44%) Frame = +2 Query: 191 RKCSLILTKILYLLNQGENFTTQEATDAFFATTKLFQSKEIMLRRMVYLCIKELSKLAQD 370 +KC I KIL ++ F + T LF + ++ ++ C ++L + Q Sbjct: 60 QKCLEITVKILKIVAYLVTFVIVLGSGVISKGTLLFMTSQLKPDKVTVFCNRDLGREKQF 119 Query: 371 VIIVTSS 391 ++ + S+ Sbjct: 120 IVKLPSA 126 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 23.8 bits (49), Expect = 0.88 Identities = 14/67 (20%), Positives = 30/67 (44%) Frame = +2 Query: 191 RKCSLILTKILYLLNQGENFTTQEATDAFFATTKLFQSKEIMLRRMVYLCIKELSKLAQD 370 +KC I KIL ++ F + T LF + ++ ++ C ++L + Q Sbjct: 60 QKCLEITVKILKIVAYLVTFVIVLGSGVISKGTLLFMTSQLKPDKVTVFCNRDLGREKQF 119 Query: 371 VIIVTSS 391 ++ + S+ Sbjct: 120 IVKLPSA 126 >DQ414246-1|ABD63008.1| 126|Tribolium castaneum odd-skipped protein. Length = 126 Score = 20.6 bits (41), Expect = 8.2 Identities = 6/12 (50%), Positives = 8/12 (66%) Frame = +3 Query: 297 FSPKKSCCDVWF 332 +SP S CD W+ Sbjct: 27 YSPPPSYCDPWY 38 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 98,091 Number of Sequences: 336 Number of extensions: 1799 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11839801 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -