BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10f15 (501 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 7.2 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 7.2 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 21 7.2 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 21 9.5 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 21 9.5 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 21 9.5 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 21.0 bits (42), Expect = 7.2 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 230 LNQGENFTTQEATDAFFATTKLFQSK 307 LN G N T+ + D FF L S+ Sbjct: 550 LNSGLNKITRNSLDCFFTMNDLEPSE 575 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.0 bits (42), Expect = 7.2 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +2 Query: 230 LNQGENFTTQEATDAFFATTKLFQSK 307 LN G N T+ + D FF L S+ Sbjct: 550 LNSGLNKITRNSLDCFFTMNDLEPSE 575 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 21.0 bits (42), Expect = 7.2 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +2 Query: 143 IVLQETREFNQTLVIPRKCSLILTKILYLLNQG 241 I+LQ ++ T I K S I K + L+N G Sbjct: 565 IILQAPSLYDTTKPIDIKYSKIAKKKMMLMNMG 597 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 20.6 bits (41), Expect = 9.5 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +2 Query: 92 KDEDDNSSNPYQNLDKTIVLQETREF 169 +DED S P NL ++ +EF Sbjct: 162 QDEDVICSTPIGNLSHALLKDPVKEF 187 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 20.6 bits (41), Expect = 9.5 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +2 Query: 92 KDEDDNSSNPYQNLDKTIVLQETREF 169 +DED S P NL ++ +EF Sbjct: 215 QDEDIICSTPIGNLSHALLKDPVKEF 240 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 20.6 bits (41), Expect = 9.5 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = +1 Query: 199 FINTYENTVFTESRRKFHHSGG 264 ++ + NT + K+H SGG Sbjct: 189 YLKSENNTELSRVGTKYHRSGG 210 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,833 Number of Sequences: 438 Number of extensions: 1927 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13741392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -