BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10f13 (731 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_01_0204 + 1611837-1611840,1611926-1612048,1614570-1614659,161... 28 6.6 >03_01_0204 + 1611837-1611840,1611926-1612048,1614570-1614659, 1615529-1616095,1616235-1616959,1617065-1617252, 1617331-1617778 Length = 714 Score = 28.3 bits (60), Expect = 6.6 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -2 Query: 220 LVY-CCF*DSLQPVKNILYINVSSPAPRTTPAAIGTQLFPSLSLIIT 83 ++Y CCF P+ N+L + P+ R +I T F +S+I+T Sbjct: 605 IIYVCCFVMGFGPIPNVLCSELFPPSCRNRCMSICTLTFWIVSIIVT 651 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,101,388 Number of Sequences: 37544 Number of extensions: 367626 Number of successful extensions: 811 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 790 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 811 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1921741964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -