BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10f13 (731 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21308| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) 28 6.8 >SB_21308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2641 Score = 30.7 bits (66), Expect = 1.3 Identities = 15/61 (24%), Positives = 29/61 (47%) Frame = -1 Query: 284 YLTRSGASFLASALKRDSYLLVGVLLFLRFSAAGEEHLIYQC*QSSSQDNACCDRHPVIS 105 Y G S K+ ++L +G L +RF++ +++ Q+ + D D PV+S Sbjct: 2242 YADVKGQVLKLSDFKQKTFLPIGKSLHIRFTSPTNSSAMFKAVQADTDDGLTLDDKPVLS 2301 Query: 104 I 102 + Sbjct: 2302 V 2302 >SB_30332| Best HMM Match : RVT_1 (HMM E-Value=2.7e-34) Length = 1683 Score = 28.3 bits (60), Expect = 6.8 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -1 Query: 653 WQPLPNIQLPNFLYINPINASTKVEPPRTRSQLESSGKL 537 W P L NF+ NP+N T + RT S L SS +L Sbjct: 698 WNPFDTDTLGNFIKWNPVNTDTPL--IRTPSGLSSSVRL 734 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,280,959 Number of Sequences: 59808 Number of extensions: 426614 Number of successful extensions: 1039 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 953 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1039 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -