BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10f08 (656 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43857| Best HMM Match : MAP1_LC3 (HMM E-Value=0) 235 2e-62 SB_13547| Best HMM Match : MAP1_LC3 (HMM E-Value=0) 95 6e-20 SB_37033| Best HMM Match : Annexin (HMM E-Value=0) 31 0.62 SB_52412| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_55930| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_13733| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_40533| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) 28 7.7 >SB_43857| Best HMM Match : MAP1_LC3 (HMM E-Value=0) Length = 119 Score = 235 bits (575), Expect = 2e-62 Identities = 106/116 (91%), Positives = 114/116 (98%) Frame = +3 Query: 66 MKFQYKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQF 245 MK++YKEEH FEKR+AEGEKIR+KYPDRVPVIVEKAPKAR+GDLDKKKYLVPSDLTVGQF Sbjct: 1 MKWEYKEEHPFEKRRAEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF 60 Query: 246 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYG 413 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMG LYQEHH+EDFFLYIA+SDE+VYG Sbjct: 61 YFLIRKRIHLRPEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG 116 >SB_13547| Best HMM Match : MAP1_LC3 (HMM E-Value=0) Length = 140 Score = 94.7 bits (225), Expect = 6e-20 Identities = 48/115 (41%), Positives = 71/115 (61%), Gaps = 2/115 (1%) Frame = +3 Query: 78 YKEEHSFEKRKAEGEKIRRKYPDRVPVIVEKAPKAR-LGDLDKKKYLVPSDLTVGQFYFL 254 +K+ SF R+ E IR K+P ++PVIVE+ K + L LDK K+LVP +LT+ QF + Sbjct: 14 FKQRKSFVSRRDEVAGIRAKFPSKIPVIVERYHKEKDLPLLDKTKFLVPQELTMSQFVTI 73 Query: 255 IRKRIHLRPEDALFFFVNN-VIPPTSATMGSLYQEHHDEDFFLYIAFSDENVYGN 416 IR R+ L A + VNN + S TM LY+E DED FLY+ ++ + ++G+ Sbjct: 74 IRNRMSLSSTQAFYLIVNNKSLASMSMTMAELYREEKDEDGFLYMVYASQEMFGS 128 >SB_37033| Best HMM Match : Annexin (HMM E-Value=0) Length = 287 Score = 31.5 bits (68), Expect = 0.62 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = -1 Query: 653 IFYYSXDDTQPKQRCENKAILYLL 582 IF+Y+ D K C+NKA++YLL Sbjct: 88 IFFYTLDIASNKPGCDNKALMYLL 111 >SB_52412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 485 Score = 29.1 bits (62), Expect = 3.3 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -1 Query: 407 DIFVGKC-YV*KEIFIMVFLVERPHCCRCGWNDIVHEEEKCVFRPQVNTFPDQE 249 D+ VG C Y + L +RP +++V ++++ VF+P +T DQ+ Sbjct: 132 DLAVGYCQYDHLASVLTQLLTDRPEASTEILDELVRDKKRAVFKPNFDTIQDQQ 185 >SB_55930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 643 Score = 28.7 bits (61), Expect = 4.4 Identities = 18/52 (34%), Positives = 29/52 (55%) Frame = -1 Query: 446 NYLKVNNLELISIDIFVGKCYV*KEIFIMVFLVERPHCCRCGWNDIVHEEEK 291 N L+ NN +L + +F G C+V K + IM FLV C R + + +++K Sbjct: 586 NCLEYNNTQL-AYTVF-GLCFVCKLVVIMGFLVSYLSCRRINKSTRLRQDDK 635 >SB_13733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1455 Score = 28.7 bits (61), Expect = 4.4 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = +3 Query: 147 RVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLR 278 RV + + + + D K YL P D G+FY L +IH+R Sbjct: 214 RVTTYINRMHTDGIINQDTKSYLTPKDSKPGRFYIL--PKIHIR 255 >SB_40533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 319 Score = 28.3 bits (60), Expect = 5.8 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +3 Query: 144 DRVPVIVEKAPKARLGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRP 281 +RV + + + + D K YL P D G+FY L + H P Sbjct: 81 ERVTTYINRMHTDGIINQDTKSYLTPKDSKPGRFYILPKIHKHGNP 126 >SB_42248| Best HMM Match : Keratin_B2 (HMM E-Value=4.4) Length = 736 Score = 27.9 bits (59), Expect = 7.7 Identities = 19/80 (23%), Positives = 35/80 (43%), Gaps = 4/80 (5%) Frame = +2 Query: 329 CNNGVSLPRTP**RFLSIHSIFRRKCLWKLIPNYSLSNS----FTLSDHMVKFNLSLRLK 496 C N SLP P + + ++ +++C +Y L + F+ SD + L L Sbjct: 383 CGNRGSLPPPPPGQLAKLLAVRQKQCEKYPTSHYMLKVAHLQYFSYSDSKINSKLKLNYV 442 Query: 497 LCIILWYFFIINWHIILYLS 556 LC+ W + H++ +S Sbjct: 443 LCLNTWLSDQFDKHMVYIVS 462 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,029,932 Number of Sequences: 59808 Number of extensions: 357599 Number of successful extensions: 843 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 800 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 841 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -