BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10f07 (619 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 1.4 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 23 2.4 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 21 9.6 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 21 9.6 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 21 9.6 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 23.8 bits (49), Expect = 1.4 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 9/35 (25%) Frame = +3 Query: 495 PSQPTHYRTCT---------SWTWPPLGS*SRILT 572 P QP H TCT SW PPL + + ++T Sbjct: 1081 PEQPPHDTTCTTLTSQTIRISWMSPPLSAANGVIT 1115 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 23.0 bits (47), Expect = 2.4 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -2 Query: 222 LSCGILGSVCVTLLY 178 L CGILGS+ V Y Sbjct: 369 LVCGILGSILVPFFY 383 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.0 bits (42), Expect = 9.6 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +2 Query: 527 VLDLAAAGFIKPHIDAVRFCGDVIAGVCLC 616 V DLA A + P A G I G+ LC Sbjct: 80 VADLAVAILVMPFNVAYLLLGKWIFGIHLC 109 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.0 bits (42), Expect = 9.6 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +2 Query: 527 VLDLAAAGFIKPHIDAVRFCGDVIAGVCLC 616 V DLA A + P A G I G+ LC Sbjct: 80 VADLAVAILVMPFNVAYLLLGKWIFGIHLC 109 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 21.0 bits (42), Expect = 9.6 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +2 Query: 527 VLDLAAAGFIKPHIDAVRFCGDVIAGVCLC 616 V DLA A + P A G I G+ LC Sbjct: 80 VADLAVAILVMPFNVAYLLLGKWIFGIHLC 109 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,738 Number of Sequences: 438 Number of extensions: 3370 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18337950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -