BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10f06 (612 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 30 0.068 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 25 1.9 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 24 3.4 AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. 24 4.4 AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-tran... 23 5.9 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 29.9 bits (64), Expect = 0.068 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +3 Query: 441 GERRISPRARPQAGE*RHQQHPGGHQDLREQLQR 542 GER + P+ R Q + +HQQ Q R+Q QR Sbjct: 294 GERYVPPQLRQQRQQQQHQQQQQQQQQQRQQQQR 327 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 25.0 bits (52), Expect = 1.9 Identities = 15/55 (27%), Positives = 26/55 (47%) Frame = +1 Query: 430 NTSWESGASALEHALKLESDVTNSIREVIKTCESSFNDYHLVDYLSGEFLDEQYK 594 NT ASA A++ + V +E S ND+++ D++SG + + K Sbjct: 828 NTITYGTASAPFLAIRTLNQVLEDNKEKYPLAASRINDFYVDDFISGADSENEAK 882 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 24.2 bits (50), Expect = 3.4 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -2 Query: 539 LKLLSQVLMTSRMLLVTSLSSL 474 LKLL+ V MTS+M+L+T L L Sbjct: 897 LKLLA-VCMTSQMMLITQLMPL 917 >AY578796-1|AAT07301.1| 437|Anopheles gambiae Gbb-60A protein. Length = 437 Score = 23.8 bits (49), Expect = 4.4 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 192 DLLQHDEETDPGGSGRVNPVLS 257 D LQ +E P G+GR+ V S Sbjct: 98 DQLQQEETDAPAGAGRIRKVRS 119 >AY070257-1|AAL59656.1| 217|Anopheles gambiae glutathione S-transferase e8 protein. Length = 217 Score = 23.4 bits (48), Expect = 5.9 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -1 Query: 225 LDLFPHHVVASLLHGEPLIPDGDGADVTLC 136 L + P H V L HGE + D V LC Sbjct: 46 LKINPLHTVPVLRHGELTLTDSHAILVYLC 75 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 573,271 Number of Sequences: 2352 Number of extensions: 12090 Number of successful extensions: 41 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 37 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 59711994 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -