BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10f04 (721 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 1.9 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 1.9 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 1.9 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 1.9 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 1.9 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 1.9 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 23 1.9 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 23 1.9 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 1.9 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 22 4.4 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 535 MEDSGAPAAHCSPNTAPATSLATPRSRSTTP 627 + +GAP P + P+ S AT S T+P Sbjct: 116 LSTNGAPPRSTPPLSTPSNSNATKSSGLTSP 146 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 535 MEDSGAPAAHCSPNTAPATSLATPRSRSTTP 627 + +GAP P + P+ S AT S T+P Sbjct: 116 LSTNGAPPRSTPPLSTPSNSNATKSSGLTSP 146 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 535 MEDSGAPAAHCSPNTAPATSLATPRSRSTTP 627 + +GAP P + P+ S AT S T+P Sbjct: 116 LSTNGAPPRSTPPLSTPSNSNATKSSGLTSP 146 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 535 MEDSGAPAAHCSPNTAPATSLATPRSRSTTP 627 + +GAP P + P+ S AT S T+P Sbjct: 116 LSTNGAPPRSTPPLSTPSNSNATKSSGLTSP 146 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 535 MEDSGAPAAHCSPNTAPATSLATPRSRSTTP 627 + +GAP P + P+ S AT S T+P Sbjct: 116 LSTNGAPPRSTPPLSTPSNSNATKSSGLTSP 146 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 535 MEDSGAPAAHCSPNTAPATSLATPRSRSTTP 627 + +GAP P + P+ S AT S T+P Sbjct: 72 LSTNGAPPRSTPPLSTPSNSNATKSSGLTSP 102 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 535 MEDSGAPAAHCSPNTAPATSLATPRSRSTTP 627 + +GAP P + P+ S AT S T+P Sbjct: 116 LSTNGAPPRSTPPLSTPSNSNATKSSGLTSP 146 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 535 MEDSGAPAAHCSPNTAPATSLATPRSRSTTP 627 + +GAP P + P+ S AT S T+P Sbjct: 116 LSTNGAPPRSTPPLSTPSNSNATKSSGLTSP 146 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +1 Query: 535 MEDSGAPAAHCSPNTAPATSLATPRSRSTTP 627 + +GAP P + P+ S AT S T+P Sbjct: 116 LSTNGAPPRSTPPLSTPSNSNATKSSGLTSP 146 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 22.2 bits (45), Expect = 4.4 Identities = 11/30 (36%), Positives = 14/30 (46%), Gaps = 1/30 (3%) Frame = -2 Query: 387 CTCSLCAE-EAGAAVRLVLVDGSPAYVATH 301 C C+ G V +VL+D AY A H Sbjct: 503 CECTHVVNIPLGTVVEMVLIDKGYAYDANH 532 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,832 Number of Sequences: 336 Number of extensions: 1628 Number of successful extensions: 13 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19155320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -