BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10f04 (721 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 2.9 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 8.9 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = +1 Query: 541 DSGAPAAHCSPNTAPATSLATPRSRSTTPS 630 + GAPA + T T+ T + +TTP+ Sbjct: 650 EPGAPATTITTITTTTTTTTTTTTTTTTPN 679 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 21.4 bits (43), Expect = 8.9 Identities = 14/51 (27%), Positives = 19/51 (37%) Frame = +2 Query: 47 YFLMNLKKK*ALNSVVCFPGTNEKVVLINKKNLKRVKRLSTLAASMSLKSC 199 YF + NS V F E+ IN+KN + + KSC Sbjct: 142 YFYSKSNGSNSSNSDVLFKQNKEEEQTINRKNSDYLDNQEVSMENTENKSC 192 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,076 Number of Sequences: 438 Number of extensions: 1888 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22292145 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -