BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10f04 (721 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g68900.1 68414.m07885 mandelate racemase/muconate lactonizing... 29 2.3 At1g54570.1 68414.m06223 esterase/lipase/thioesterase family pro... 29 3.1 >At1g68900.1 68414.m07885 mandelate racemase/muconate lactonizing enzyme C-terminal domain-containing protein / hydrolase, alpha/beta fold family protein contains Pfam profiles PF01188: Mandelate racemase / muconate lactonizing enzyme, C-terminal domain, PF00561: hydrolase, alpha/beta fold family Length = 656 Score = 29.5 bits (63), Expect = 2.3 Identities = 16/54 (29%), Positives = 27/54 (50%) Frame = -3 Query: 551 APLSSMAALAEHYVTHVRTVRPHQPYLLLGYSFGAAVAFEMALHLGACISSSIM 390 +P SM +AE + + P + ++GYS GA +A MAL I +++ Sbjct: 432 SPTFSMEMIAEALYKLIEQITPGK-VTIVGYSMGARIALYMALRFSNKIEGAVV 484 >At1g54570.1 68414.m06223 esterase/lipase/thioesterase family protein contains Interpro entry IPR000379 Length = 704 Score = 29.1 bits (62), Expect = 3.1 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = -3 Query: 548 PLSSMAALAEHYVTHVRTVRPHQPYLLLGYSFGAAVAFEMA 426 P + + E + + RP++P L+G SFG +A +A Sbjct: 166 PFEGLLKVVEDVLRQEQATRPNKPIYLVGDSFGGCLALAVA 206 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,182,686 Number of Sequences: 28952 Number of extensions: 131481 Number of successful extensions: 459 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 449 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 459 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1565336320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -