BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10f02 (345 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4PBB3 Cluster: Putative uncharacterized protein; n=1; ... 31 5.3 UniRef50_Q1FN98 Cluster: Putative uncharacterized protein; n=1; ... 31 6.9 >UniRef50_Q4PBB3 Cluster: Putative uncharacterized protein; n=1; Ustilago maydis|Rep: Putative uncharacterized protein - Ustilago maydis (Smut fungus) Length = 627 Score = 31.1 bits (67), Expect = 5.3 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +3 Query: 48 FNVSFMHYVKKKLALCTSSLY 110 FN S +H + ++L LCTSS+Y Sbjct: 487 FNASIVHVIARELELCTSSIY 507 >UniRef50_Q1FN98 Cluster: Putative uncharacterized protein; n=1; Clostridium phytofermentans ISDg|Rep: Putative uncharacterized protein - Clostridium phytofermentans ISDg Length = 414 Score = 30.7 bits (66), Expect = 6.9 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 8/50 (16%) Frame = +1 Query: 106 YILYSLAVVSTTFNCSRIEHLSSATMKTRS------SRTFEN--KCEINS 231 Y + SLA ST + C R +L+S T+K+ S TF + KC+ NS Sbjct: 313 YYITSLATGSTVYKCGRTTYLTSGTVKSSSDSWTINGTTFTDLLKCDYNS 362 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 212,793,489 Number of Sequences: 1657284 Number of extensions: 2997378 Number of successful extensions: 4551 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4520 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4551 length of database: 575,637,011 effective HSP length: 89 effective length of database: 428,138,735 effective search space used: 10703468375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -