BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10e24 (663 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC110813-1|AAI10814.1| 519|Homo sapiens cAMP responsive element... 31 3.7 AK131517-1|BAD18659.1| 460|Homo sapiens protein ( Homo sapiens ... 31 3.7 AJ549387-1|CAD79347.1| 519|Homo sapiens basic transcription fac... 31 3.7 AJ549094-1|CAD79344.1| 396|Homo sapiens FUS/BBF2H7 protein prot... 31 3.7 AJ549093-1|CAD79343.1| 396|Homo sapiens FUS/BBF2H7 protein prot... 31 3.7 AJ549092-1|CAD79342.1| 519|Homo sapiens basic transcription fac... 31 3.7 Z68289-1|CAI41998.1| 696|Homo sapiens melanoma associated antig... 31 4.9 AK090835-1|BAC03529.1| 450|Homo sapiens protein ( Homo sapiens ... 31 4.9 AK056478-1|BAB71194.1| 637|Homo sapiens protein ( Homo sapiens ... 31 4.9 >BC110813-1|AAI10814.1| 519|Homo sapiens cAMP responsive element binding protein 3-like 2 protein. Length = 519 Score = 31.1 bits (67), Expect = 3.7 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = +2 Query: 326 VRARLEKHMGSNLVRLTDKNYMTELEERIRAVNEENLNKRISSRVLDEMER 478 +R +++ + + R K YM LE+++ + + ENL R VL+ R Sbjct: 297 IRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNR 347 >AK131517-1|BAD18659.1| 460|Homo sapiens protein ( Homo sapiens cDNA FLJ16743 fis, clone CTONG2003348, moderately similar to Mus musculus mRNA for OASIS protein. ). Length = 460 Score = 31.1 bits (67), Expect = 3.7 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = +2 Query: 326 VRARLEKHMGSNLVRLTDKNYMTELEERIRAVNEENLNKRISSRVLDEMER 478 +R +++ + + R K YM LE+++ + + ENL R VL+ R Sbjct: 298 IRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNR 348 >AJ549387-1|CAD79347.1| 519|Homo sapiens basic transcription factor 2 homologue protein. Length = 519 Score = 31.1 bits (67), Expect = 3.7 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = +2 Query: 326 VRARLEKHMGSNLVRLTDKNYMTELEERIRAVNEENLNKRISSRVLDEMER 478 +R +++ + + R K YM LE+++ + + ENL R VL+ R Sbjct: 297 IRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNR 347 >AJ549094-1|CAD79344.1| 396|Homo sapiens FUS/BBF2H7 protein protein. Length = 396 Score = 31.1 bits (67), Expect = 3.7 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = +2 Query: 326 VRARLEKHMGSNLVRLTDKNYMTELEERIRAVNEENLNKRISSRVLDEMER 478 +R +++ + + R K YM LE+++ + + ENL R VL+ R Sbjct: 174 IRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNR 224 >AJ549093-1|CAD79343.1| 396|Homo sapiens FUS/BBF2H7 protein protein. Length = 396 Score = 31.1 bits (67), Expect = 3.7 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = +2 Query: 326 VRARLEKHMGSNLVRLTDKNYMTELEERIRAVNEENLNKRISSRVLDEMER 478 +R +++ + + R K YM LE+++ + + ENL R VL+ R Sbjct: 174 IRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNR 224 >AJ549092-1|CAD79342.1| 519|Homo sapiens basic transcription factor 2 homologue protein. Length = 519 Score = 31.1 bits (67), Expect = 3.7 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = +2 Query: 326 VRARLEKHMGSNLVRLTDKNYMTELEERIRAVNEENLNKRISSRVLDEMER 478 +R +++ + + R K YM LE+++ + + ENL R VL+ R Sbjct: 297 IRRKIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNR 347 >Z68289-1|CAI41998.1| 696|Homo sapiens melanoma associated antigen (mutated) 1-like 1 protein. Length = 696 Score = 30.7 bits (66), Expect = 4.9 Identities = 26/87 (29%), Positives = 41/87 (47%), Gaps = 4/87 (4%) Frame = +2 Query: 395 ELEERIRAVNEENLNKRISSRVLD---EMERLKRLILVGKT-PLKECPPELFHHPVFVFW 562 ELEE +A ++ L RI+ +LD E E L R IL +T P + F + + FW Sbjct: 347 ELEEEGQASDKSLLPSRINLSLLDDDEEDEELPRFILHYETHPFETGMIVWFKYQKYPFW 406 Query: 563 RMVNREVARASKKRADAYYRKLKASQK 643 V + + R +K + + S+K Sbjct: 407 PAVIKSIRRKERKASVLFVEANMNSEK 433 >AK090835-1|BAC03529.1| 450|Homo sapiens protein ( Homo sapiens cDNA FLJ33516 fis, clone BRAMY2005684, moderately similar to UBE-1c2. ). Length = 450 Score = 30.7 bits (66), Expect = 4.9 Identities = 26/87 (29%), Positives = 41/87 (47%), Gaps = 4/87 (4%) Frame = +2 Query: 395 ELEERIRAVNEENLNKRISSRVLD---EMERLKRLILVGKT-PLKECPPELFHHPVFVFW 562 ELEE +A ++ L RI+ +LD E E L R IL +T P + F + + FW Sbjct: 101 ELEEEGQASDKSLLPSRINLSLLDDDEEDEELPRFILHYETHPFETGMIVWFKYQKYPFW 160 Query: 563 RMVNREVARASKKRADAYYRKLKASQK 643 V + + R +K + + S+K Sbjct: 161 PAVIKSIRRKERKASVLFVEANMNSEK 187 >AK056478-1|BAB71194.1| 637|Homo sapiens protein ( Homo sapiens cDNA FLJ31916 fis, clone NT2RP7004915, moderately similar to Mus musculus mRNA for UBE-1c2. ). Length = 637 Score = 30.7 bits (66), Expect = 4.9 Identities = 26/87 (29%), Positives = 41/87 (47%), Gaps = 4/87 (4%) Frame = +2 Query: 395 ELEERIRAVNEENLNKRISSRVLD---EMERLKRLILVGKT-PLKECPPELFHHPVFVFW 562 ELEE +A ++ L RI+ +LD E E L R IL +T P + F + + FW Sbjct: 347 ELEEEGQASDKSLLPSRINLSLLDDDEEDEELPRFILHYETHPFETGMIVWFKYQKYPFW 406 Query: 563 RMVNREVARASKKRADAYYRKLKASQK 643 V + + R +K + + S+K Sbjct: 407 PAVIKSIRRKERKASVLFVEANMNSEK 433 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,248,108 Number of Sequences: 237096 Number of extensions: 1777331 Number of successful extensions: 9452 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 9221 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9452 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7478817430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -