BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10e24 (663 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g07810.1 68418.m00895 SNF2 domain-containing protein / helica... 32 0.39 At3g54670.1 68416.m06049 structural maintenance of chromosomes (... 31 0.52 At2g13960.1 68415.m01551 myb family transcription factor contain... 31 0.68 At2g45540.1 68415.m05663 WD-40 repeat family protein / beige-rel... 30 1.2 At2g40950.1 68415.m05056 bZIP transcription factor family protei... 30 1.2 At3g10440.1 68416.m01252 hypothetical protein 30 1.6 At1g79560.1 68414.m09275 FtsH protease, putative contains simila... 29 2.1 At5g15990.1 68418.m01869 hypothetical protein very low similarit... 29 3.6 At1g32480.1 68414.m04008 isocitrate/isopropylmalate dehydrogenas... 29 3.6 At3g60920.1 68416.m06815 beige/BEACH domain-containing protein c... 28 4.8 At4g22214.1 68417.m03212 expressed protein 28 6.4 At3g52690.1 68416.m05804 hypothetical protein predicted proteins... 28 6.4 At4g23530.1 68417.m03391 expressed protein 27 8.4 At2g36740.1 68415.m04507 YL1 nuclear family protein similar to Y... 27 8.4 At1g10520.1 68414.m01184 DNA polymerase lambda (POLL) identical ... 27 8.4 >At5g07810.1 68418.m00895 SNF2 domain-containing protein / helicase domain-containing protein / HNH endonuclease domain-containing protein similar to HepA-related protein HARP [Homo sapiens] GI:6693791; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF01844: HNH endonuclease Length = 1190 Score = 31.9 bits (69), Expect = 0.39 Identities = 26/97 (26%), Positives = 48/97 (49%) Frame = +2 Query: 272 LPRWWQAKVIQYAFAHPHVRARLEKHMGSNLVRLTDKNYMTELEERIRAVNEENLNKRIS 451 LPRW + VI Y H+R + + + L+ D+++ +R +++ I Sbjct: 290 LPRWPKVVVISYKMLQ-HLRTTMLEREWALLI--VDESH------HLRCSKKKSDPPEIK 340 Query: 452 SRVLDEMERLKRLILVGKTPLKECPPELFHHPVFVFW 562 + VLD E++K +IL+ TP P ++FH + + W Sbjct: 341 T-VLDVAEKVKHIILLSGTPSVSRPFDIFHQ-INMLW 375 >At3g54670.1 68416.m06049 structural maintenance of chromosomes (SMC) family protein similar to SMC1 protein [Bos taurus] GI:4235253, 14S cohesin SMC1 subunit (SMC protein) [Xenopus laevis] GI:3328231; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1257 Score = 31.5 bits (68), Expect = 0.52 Identities = 17/55 (30%), Positives = 27/55 (49%) Frame = +2 Query: 326 VRARLEKHMGSNLVRLTDKNYMTELEERIRAVNEENLNKRISSRVLDEMERLKRL 490 +RA EKH+ + K + ELE+++ + E SR+ +E LKRL Sbjct: 462 LRALQEKHVNAREASAKLKTRIAELEDQLSDLTAERYENERDSRLTQAVESLKRL 516 >At2g13960.1 68415.m01551 myb family transcription factor contains PFAM profile: PF00249 myb-like DNA binding domain Length = 150 Score = 31.1 bits (67), Expect = 0.68 Identities = 21/78 (26%), Positives = 37/78 (47%) Frame = +3 Query: 315 PTRTSVRGWRSTWDQTWCGSRTRTT*PNWKKELELSTKKI*TKESLAECLMRWKD*KD*S 494 P R + GW D+T + + WKK E ++ + +CL RW+ + Sbjct: 70 PMRRAKGGWTPEEDETLRRAVEKYKGKRWKKIAEFFPER-----TQVQCLHRWQKVLNPE 124 Query: 495 LLEKPR*RSVLLNFSTTQ 548 L++ P + VLL+FS ++ Sbjct: 125 LVKGPWTQEVLLSFSCSE 142 >At2g45540.1 68415.m05663 WD-40 repeat family protein / beige-related contains Pfam PF02138: Beige/BEACH domain; contains Pfam PF00400: WD domain, G-beta repeat (3 copies) Length = 2946 Score = 30.3 bits (65), Expect = 1.2 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 5/45 (11%) Frame = -3 Query: 508 GFSNKDQSF--QSFHLI---KHSARDSFVQIFFVDSSNSFFQFGH 389 G KD+S+ S H I ++ R S +++F VD SN FF FG+ Sbjct: 2149 GDQEKDRSWPMSSLHQIYSRRYLLRRSALELFMVDRSNFFFDFGN 2193 >At2g40950.1 68415.m05056 bZIP transcription factor family protein similar to AtbZIP transcription factor GI:17065880 from [Arabidopsis thaliana]; contains Pfam profile: bZIP transcription factor PF00170 Length = 721 Score = 30.3 bits (65), Expect = 1.2 Identities = 24/76 (31%), Positives = 40/76 (52%), Gaps = 3/76 (3%) Frame = +2 Query: 329 RARLEKHMGS-NLVRLTDKNYMTELEERIRAVNE--ENLNKRISSRVLDEMERLKRLILV 499 RARL ++ S L R K+Y+ ELEE++R ++ +LN +IS + + ++L Sbjct: 232 RARLMRNRESAQLSRQRKKHYVEELEEKVRNMHSTITDLNGKISYFMAENATLRQQLGGN 291 Query: 500 GKTPLKECPPELFHHP 547 G P PP + +P Sbjct: 292 GMCPPHLPPPPMGMYP 307 >At3g10440.1 68416.m01252 hypothetical protein Length = 556 Score = 29.9 bits (64), Expect = 1.6 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = +1 Query: 289 GKSDTICLCPPARPCAAGEAHGIKPGAAHGQELHDRIGRKN*SCQRR 429 G D + AR CA+ ++ G KP A ++ +RIG+ S +R+ Sbjct: 425 GPHDDQTIAANARCCASEQSIGSKPEAVEPHDIEERIGKIRVSSRRQ 471 >At1g79560.1 68414.m09275 FtsH protease, putative contains similarity to chloroplast FtsH protease GI:5804782 from [Nicotiana tabacum] Length = 1008 Score = 29.5 bits (63), Expect = 2.1 Identities = 25/98 (25%), Positives = 43/98 (43%), Gaps = 1/98 (1%) Frame = +2 Query: 248 MKRFQLPNLPRWWQAKVIQYAFAHPHVRARLEKHMGSNLVRLTDKNYMTELEERIRAVNE 427 +K+ + +LP ++I+Y + HPHV S L Y+ E EE A+N Sbjct: 875 VKKIGMVDLPDNPDGELIKYRWDHPHVMPAEMSVEVSELFTRELTRYIEETEE--LAMNA 932 Query: 428 ENLNKRISSRVLDEMERLKRLI-LVGKTPLKECPPELF 538 N+ I + E+ R+ L + +K+ P +F Sbjct: 933 LRANRHILDLITRELLEKSRITGLEVEEKMKDLSPLMF 970 >At5g15990.1 68418.m01869 hypothetical protein very low similarity to tropomyosin [Crassostrea gigas] GI:15419048 Length = 115 Score = 28.7 bits (61), Expect = 3.6 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +2 Query: 419 VNEENLNKRISSRVLDEMERLKRLILVGKTPLKECPPELFHHPVFVFWRM 568 +++ ++ K + +LDE+ERL R V + + E H VF RM Sbjct: 21 IDDNHIFKWVDEALLDEIERLARRTTVLEETISHITTESTDHKKMVFERM 70 >At1g32480.1 68414.m04008 isocitrate/isopropylmalate dehydrogenase family protein similar to NAD+ dependent isocitrate dehydrogenase subunit 2 [Arabidopsis thaliana] GI:1766048; contains Pfam profile PF00180 dehydrogenase, isocitrate/isopropylmalate family Length = 294 Score = 28.7 bits (61), Expect = 3.6 Identities = 17/76 (22%), Positives = 35/76 (46%), Gaps = 3/76 (3%) Frame = +2 Query: 188 VKIQVEGEDETGEGEMSRKKMKRFQLPNLPRWWQAKVIQYAFAHPHVRARLE---KHMGS 358 ++ EGE E E+ ++ FQ+ + ++W ++ +YAF + H R + H Sbjct: 100 IRENTEGEYAGREHEVVPGVIESFQV-TMTKFWSDRIAKYAFEYAHFSKRKKVTAVHNNG 158 Query: 359 NLVRLTDKNYMTELEE 406 +L D ++ +E Sbjct: 159 KYEKLADAFFLESCQE 174 >At3g60920.1 68416.m06815 beige/BEACH domain-containing protein contains Pfam PF02138: Beige/BEACH domain; similar to LBA isoform gamma (GI:10257405) [Mus musculus]; similar to beige-like protein (CDC4L) - Homo sapiens; similar to Neurobeachin: kinase A-anchoring, beige/Chediak-higashi protein homolog implicated in neuronal membrane traffic (AKAP550) (GI:11863541) [Drosophila melanogaster]. Length = 1928 Score = 28.3 bits (60), Expect = 4.8 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = -3 Query: 502 SNKDQSFQSFHLIKHSARDSFVQIFFVDSSNSFFQFGH 389 S+ Q + +L+K SA +++F VD SN FF FG+ Sbjct: 1595 SSLHQIYSRRYLLKKSA----LELFMVDRSNFFFDFGN 1628 >At4g22214.1 68417.m03212 expressed protein Length = 188 Score = 27.9 bits (59), Expect = 6.4 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 565 NG*QGSCKSIKKTCRCLLQETESFPEIRSIDG 660 NG G S+ TC C ++E S PEI +++G Sbjct: 80 NGPPGGV-SLTATCNCCVREKVSPPEIEAVEG 110 >At3g52690.1 68416.m05804 hypothetical protein predicted proteins, Arabidopsis thaliana Length = 299 Score = 27.9 bits (59), Expect = 6.4 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 182 CPYHPDLFCFQFYPPFLLSNLII 114 CP DLF +Q+YP ++ N II Sbjct: 50 CPNLEDLFMYQYYPLDVVMNFII 72 >At4g23530.1 68417.m03391 expressed protein Length = 396 Score = 27.5 bits (58), Expect = 8.4 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = +2 Query: 389 MTELEERIRAVNEENLNKRISSRVLDEMERLKRLILVGKTPLKECPPELFHHPV 550 + E ER R +E ++ +V DEME + R + VG L+ ++FH V Sbjct: 328 LMEFAERFRFPADEEEEVEVAEKV-DEMEEICRRMEVGLEDLQRQVRQVFHRLV 380 >At2g36740.1 68415.m04507 YL1 nuclear family protein similar to YL-1 protein (Transcription factor-like 1) (Swiss-Prot:Q15906) [Homo sapiens] Length = 379 Score = 27.5 bits (58), Expect = 8.4 Identities = 17/59 (28%), Positives = 30/59 (50%) Frame = +2 Query: 368 RLTDKNYMTELEERIRAVNEENLNKRISSRVLDEMERLKRLILVGKTPLKECPPELFHH 544 ++ ++ MT+ E + A E +N R RVL E +K+ +V K K P++ +H Sbjct: 196 KVGEEKRMTQEEMLLEAAQTEIMNLRNLERVLAREEEVKKKAIVHKAVYK--GPQIRYH 252 >At1g10520.1 68414.m01184 DNA polymerase lambda (POLL) identical to DNA polymerase lambda GI:12053869 from [Arabidopsis thaliana] Length = 529 Score = 27.5 bits (58), Expect = 8.4 Identities = 11/41 (26%), Positives = 23/41 (56%) Frame = +2 Query: 524 PPELFHHPVFVFWRMVNREVARASKKRADAYYRKLKASQKF 646 PP+L + +F +++N A +R+ +YY+ + +KF Sbjct: 197 PPDLNRNITEIFGKLINIYRALGEDRRSFSYYKAIPVIEKF 237 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,500,573 Number of Sequences: 28952 Number of extensions: 264727 Number of successful extensions: 783 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 765 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 781 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1393347168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -