BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10e20 (279 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000E46784 Cluster: PREDICTED: similar to endonuclea... 31 5.0 UniRef50_A0EGW2 Cluster: Chromosome undetermined scaffold_96, wh... 31 6.6 >UniRef50_UPI0000E46784 Cluster: PREDICTED: similar to endonuclease/reverse transcriptase; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to endonuclease/reverse transcriptase - Strongylocentrotus purpuratus Length = 576 Score = 31.1 bits (67), Expect = 5.0 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 2/52 (3%) Frame = -3 Query: 241 FFEQTVLFRVIKLNNDQ*TLHDSSAIVLNNSVSTSD--DKSVTHTRCIYTQT 92 F + +L+R IK ND+ T H + L N++S + DK V C+ T Sbjct: 235 FADDCILYRAIKTINDKVTHHHYLGVELTNNLSCENQVDKVVNKANCMLGMT 286 >UniRef50_A0EGW2 Cluster: Chromosome undetermined scaffold_96, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_96, whole genome shotgun sequence - Paramecium tetraurelia Length = 384 Score = 30.7 bits (66), Expect = 6.6 Identities = 19/43 (44%), Positives = 25/43 (58%) Frame = -3 Query: 274 FFSRINFIYT*FFEQTVLFRVIKLNNDQ*TLHDSSAIVLNNSV 146 FFSR+ +YT Q++ F V +NN Q T D +A LN SV Sbjct: 61 FFSRVKDLYTHLGWQSIKFIVKDINNPQLTADDINA--LNQSV 101 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 251,032,868 Number of Sequences: 1657284 Number of extensions: 4102559 Number of successful extensions: 7904 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7818 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7904 length of database: 575,637,011 effective HSP length: 70 effective length of database: 459,627,131 effective search space used: 10111796882 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -