BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10e20 (279 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_1564| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 2.3 SB_24967| Best HMM Match : Drf_FH1 (HMM E-Value=0.65) 26 5.4 SB_4896| Best HMM Match : TFIID_20kDa (HMM E-Value=2.3e-05) 26 5.4 SB_44101| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 7.1 >SB_1564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1066 Score = 27.1 bits (57), Expect = 2.3 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +3 Query: 135 SDVLTLLFNTIADESCNVY*SLFSFITRNKTVCSKNY 245 +D LT++F + +CN Y +LF I K KNY Sbjct: 85 ADWLTVMFGDVRACACNKYWTLFHGIDIEKKHPKKNY 121 >SB_24967| Best HMM Match : Drf_FH1 (HMM E-Value=0.65) Length = 1799 Score = 25.8 bits (54), Expect = 5.4 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -3 Query: 178 DSSAIVLNNSVSTSDDKSVTHTRCI 104 +S I L + STS D+S TH C+ Sbjct: 785 ESGMIALEKNASTSLDESSTHAYCL 809 >SB_4896| Best HMM Match : TFIID_20kDa (HMM E-Value=2.3e-05) Length = 819 Score = 25.8 bits (54), Expect = 5.4 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 162 TIADESCNVY*SLFSFITRNKTVC 233 T+++ CN Y LF +T+ VC Sbjct: 631 TLSESECNCYSLLFQHLTKEDLVC 654 >SB_44101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 25.4 bits (53), Expect = 7.1 Identities = 9/53 (16%), Positives = 28/53 (52%) Frame = -3 Query: 223 LFRVIKLNNDQ*TLHDSSAIVLNNSVSTSDDKSVTHTRCIYTQTMVESGSNLR 65 +FR++K++ + +L + N ++ ++ +V C+ Q + ++ N++ Sbjct: 1 MFRLVKIDGPKGSLLKRHCVTTNYFINRNNCIAVAALECVQYQNLTQANRNIK 53 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,000,314 Number of Sequences: 59808 Number of extensions: 134832 Number of successful extensions: 201 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 192 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 201 length of database: 16,821,457 effective HSP length: 69 effective length of database: 12,694,705 effective search space used: 291978215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -