BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10e20 (279 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 23 0.92 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 21 2.8 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 20 4.9 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 20 4.9 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 20 4.9 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 20 6.5 AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. 19 8.6 AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta... 19 8.6 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 19 8.6 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 19 8.6 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 22.6 bits (46), Expect = 0.92 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -2 Query: 71 PSSLRIPHIFRFFTKTFVIRTTS 3 P+SL +P I ++ TF++ T S Sbjct: 288 PTSLVLPLIAKYLLFTFIMNTVS 310 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 21.0 bits (42), Expect = 2.8 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = -1 Query: 63 FKNSTYFQIFYENFCDTD 10 +KN+ +QI+ +F D+D Sbjct: 27 YKNALVYQIYPRSFQDSD 44 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.2 bits (40), Expect = 4.9 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +2 Query: 242 LCVNEIYSRE 271 +CV EIYS+E Sbjct: 36 ICVPEIYSKE 45 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.2 bits (40), Expect = 4.9 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +2 Query: 242 LCVNEIYSRE 271 +CV EIYS+E Sbjct: 36 ICVPEIYSKE 45 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 20.2 bits (40), Expect = 4.9 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = +2 Query: 242 LCVNEIYSRE 271 +CV EIYS+E Sbjct: 36 ICVPEIYSKE 45 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 19.8 bits (39), Expect = 6.5 Identities = 6/21 (28%), Positives = 12/21 (57%) Frame = +1 Query: 94 FECKYIVYE*PTYHRTY*RYC 156 F+C+Y Y++ Y ++C Sbjct: 434 FQCRYPNASVTPYNKNYTKFC 454 >AY823258-1|AAX18443.1| 145|Apis mellifera pburs protein. Length = 145 Score = 19.4 bits (38), Expect = 8.6 Identities = 6/19 (31%), Positives = 11/19 (57%) Frame = -1 Query: 69 FVFKNSTYFQIFYENFCDT 13 F++ N T Q+ + C+T Sbjct: 20 FIYSNETIAQVTDDENCET 38 >AM420632-1|CAM06632.1| 145|Apis mellifera bursicon subunit beta protein precursor protein. Length = 145 Score = 19.4 bits (38), Expect = 8.6 Identities = 6/19 (31%), Positives = 11/19 (57%) Frame = -1 Query: 69 FVFKNSTYFQIFYENFCDT 13 F++ N T Q+ + C+T Sbjct: 20 FIYSNETIAQVTDDENCET 38 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 19.4 bits (38), Expect = 8.6 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +1 Query: 28 FVKNLKICGILKDEG 72 F+KNL++ I +D G Sbjct: 102 FMKNLELTQIRRDRG 116 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 19.4 bits (38), Expect = 8.6 Identities = 9/31 (29%), Positives = 17/31 (54%) Frame = -3 Query: 157 NNSVSTSDDKSVTHTRCIYTQTMVESGSNLR 65 N+ + +++ H +TQ + ES SNL+ Sbjct: 377 NSCLGSTETYYSKHNTQQFTQYIPESSSNLQ 407 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 74,363 Number of Sequences: 438 Number of extensions: 1182 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 49 effective length of database: 124,881 effective search space used: 5369883 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -