BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10e19 (452 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. 23 1.2 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 21 8.3 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 8.3 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 8.3 >DQ435333-1|ABD92648.1| 135|Apis mellifera OBP16 protein. Length = 135 Score = 23.4 bits (48), Expect = 1.2 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 Query: 82 IYRVYNGKMSTETQNVQN 135 I VYNG ++ E +NVQ+ Sbjct: 44 IDEVYNGNVNVEDENVQS 61 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 20.6 bits (41), Expect = 8.3 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 30 KFILL*CLFEKLFYFVTNLQSLQWQN 107 KFI L L+E YF N + LQ N Sbjct: 155 KFIQLPPLYEMCPYFFFNSEVLQKAN 180 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 20.6 bits (41), Expect = 8.3 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +3 Query: 30 KFILL*CLFEKLFYFVTNLQSLQWQN 107 KFI L L+E YF N + LQ N Sbjct: 155 KFIQLPPLYEMCPYFFFNSEVLQKAN 180 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 20.6 bits (41), Expect = 8.3 Identities = 10/31 (32%), Positives = 12/31 (38%) Frame = -2 Query: 424 PQFVKHFSSRTKYTGQHRNFDCKRSARATPE 332 PQ + F+ T G C S TPE Sbjct: 394 PQIRQAFAEETLQPGPSMFLKCVASGNPTPE 424 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 107,414 Number of Sequences: 438 Number of extensions: 1708 Number of successful extensions: 15 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11943513 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -