BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10e17 (722 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3H1.09c |||vacuolar amino acid transporter |Schizosaccharomy... 47 2e-06 SPBC1685.07c |||amino acid transporter |Schizosaccharomyces pomb... 38 0.001 SPCC63.04 |mok14||alpha-1,3-glucan synthase Mok14|Schizosaccharo... 31 0.22 SPAC17A5.16 |||human down-regulated in multiple cancers-1 homolo... 27 2.7 SPBC19F5.05c |ppp1|SPBC25D12.01c|pescadillo-family BRCT domain p... 27 3.6 SPAC1786.03 |cut11|SPAC24C9.01|integral membrane nucleoporin|Sch... 26 6.3 >SPAC3H1.09c |||vacuolar amino acid transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 656 Score = 47.2 bits (107), Expect = 2e-06 Identities = 22/53 (41%), Positives = 32/53 (60%) Frame = +3 Query: 540 SNFDTMIHLLKGNIGTGILAMPDAFKNAGLIFGVFCTLIMGAMCTHCMXILVQ 698 SN ++ LLK +GTG+L +P AFK GL+F LI+G + C +L+Q Sbjct: 276 SNGKAVLLLLKSFVGTGVLFLPKAFKLGGLVFSSATLLIVGVLSHICFLLLIQ 328 >SPBC1685.07c |||amino acid transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 420 Score = 37.9 bits (84), Expect = 0.001 Identities = 19/57 (33%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = +3 Query: 546 FDTMIHLLKGNIGTGILAMPDAFKNAGLIFGVFCTLIMGAMCTHC-MXILVQCSHEL 713 F ++I+L +G GIL++P+AF GL+FG T++ A + + + QC+ L Sbjct: 22 FSSVINLANTILGAGILSLPNAFTKTGLLFGCL-TIVFSAFASFLGLYFVSQCAARL 77 >SPCC63.04 |mok14||alpha-1,3-glucan synthase Mok14|Schizosaccharomyces pombe|chr 3|||Manual Length = 1369 Score = 30.7 bits (66), Expect = 0.22 Identities = 18/58 (31%), Positives = 30/58 (51%) Frame = -2 Query: 253 NY*SRD*EKYM*INAVLLRIRLAYIQYISPKNIGNTLLREHNINKSIFCWN*S*FYYY 80 N SR E+++ N V +R A + Y++P+N L +H +NK W+ +YY Sbjct: 822 NIGSRLDERFIDANGVAIRDFSAELTYLTPENSKGKLSIDHFLNKVQSRWHDEEHHYY 879 >SPAC17A5.16 |||human down-regulated in multiple cancers-1 homolog 3|Schizosaccharomyces pombe|chr 1|||Manual Length = 925 Score = 27.1 bits (57), Expect = 2.7 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -3 Query: 477 KDHHHLSLVRLIVFQLHFLDC 415 +D+ H LVR+ +F +H+L C Sbjct: 471 EDNEHSGLVRICLFIVHYLSC 491 >SPBC19F5.05c |ppp1|SPBC25D12.01c|pescadillo-family BRCT domain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 607 Score = 26.6 bits (56), Expect = 3.6 Identities = 16/57 (28%), Positives = 26/57 (45%) Frame = +3 Query: 342 LLHKNVKIKLKAMSDEKQPLLTGPNSPENVIEIQSTEPVINDDGPSTEKTKGDYCPA 512 ++H N K K ++ K + NS NV+E D+ P TE+ ++ PA Sbjct: 274 IVHGNNKNARKNIATLKSKIRDIVNSDANVVEQSEKTTEDADEEPETEENLDEFKPA 330 >SPAC1786.03 |cut11|SPAC24C9.01|integral membrane nucleoporin|Schizosaccharomyces pombe|chr 1|||Manual Length = 601 Score = 25.8 bits (54), Expect = 6.3 Identities = 18/52 (34%), Positives = 31/52 (59%) Frame = -2 Query: 196 IRLAYIQYISPKNIGNTLLREHNINKSIFCWN*S*FYYYILRAIVHDFSSLI 41 I +++ YI +N+G L+R + KSI C + F Y ILR+ + F++L+ Sbjct: 185 INVSFFNYIF-QNLG-WLIR-FSFRKSIICCLFTPFSYAILRSYIWRFAALL 233 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,545,886 Number of Sequences: 5004 Number of extensions: 49803 Number of successful extensions: 123 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 123 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 339215786 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -