BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10e17 (722 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 26 0.31 DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protei... 25 0.55 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 23 2.9 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 22 6.7 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 21 8.9 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 8.9 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 21 8.9 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 26.2 bits (55), Expect = 0.31 Identities = 13/53 (24%), Positives = 28/53 (52%) Frame = -3 Query: 546 SLMLDILNTFLMQGNSRLLFSQLKDHHHLSLVRLIVFQLHFLDCLVQLGVAVF 388 +++L + + + GN+ ++ + +++ + + V L F DCLV L V F Sbjct: 49 AILLFLFSVATVFGNTLVILAVVRERYLHTATNYFVTSLAFADCLVGLVVMPF 101 >DQ257631-1|ABB82366.1| 424|Apis mellifera yellow e3-like protein protein. Length = 424 Score = 25.4 bits (53), Expect = 0.55 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -2 Query: 517 SDAGQ*SPFVFSVEGPSSFITGSVDCISITFSGLFGPVRSGCFSS 383 S+A S FS+E S + +D + F GL + GC++S Sbjct: 291 SEAAARSFVPFSIERSSQSVAEVMDRNGVLFFGLLSDLAIGCWNS 335 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 23.0 bits (47), Expect = 2.9 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -1 Query: 341 TLFINFLCYLIEYE*SHQCFMKLINIKLFKLLVSRLRK 228 T+FIN L +L + + K+I + ++L+ LRK Sbjct: 338 TMFINILKFLKQKYVKNSKLEKVIKHDILRMLIIDLRK 375 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 21.8 bits (44), Expect = 6.7 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -2 Query: 445 DCISITFSGLFGPVRSGCFSSLIAFNL 365 D + + SGL VRS C L+ F+L Sbjct: 131 DRLWVLDSGLINNVRSVCPPQLLVFDL 157 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.4 bits (43), Expect = 8.9 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 445 DCISITFSGLFG 410 DC+++ FSG+ G Sbjct: 408 DCVTLLFSGIVG 419 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 8.9 Identities = 6/11 (54%), Positives = 10/11 (90%) Frame = -1 Query: 293 HQCFMKLINIK 261 H+CFM++ N+K Sbjct: 559 HKCFMRVENVK 569 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.4 bits (43), Expect = 8.9 Identities = 6/12 (50%), Positives = 10/12 (83%) Frame = -2 Query: 445 DCISITFSGLFG 410 DC+++ FSG+ G Sbjct: 408 DCVTLLFSGIVG 419 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,714 Number of Sequences: 438 Number of extensions: 3243 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22413960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -