BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10e16 (718 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0132 + 15087274-15087797,15089544-15089732,15090048-150901... 29 2.8 04_02_0036 - 9033411-9033746,9033961-9034032,9034122-9034222,903... 29 2.8 09_02_0250 + 6266818-6267029,6267230-6267287,6267999-6268118,627... 28 8.5 07_01_0464 - 3504264-3504475,3504842-3505031,3505310-3505408,350... 28 8.5 01_06_1100 + 34530132-34530485,34530544-34530705 28 8.5 >10_08_0132 + 15087274-15087797,15089544-15089732,15090048-15090186, 15090454-15090594,15091420-15091569,15091908-15092011, 15092258-15092432,15092714-15092823,15092906-15093073, 15093180-15093345,15093771-15094049,15094445-15094543, 15094619-15094676,15095145-15095336,15095693-15095724, 15096023-15096117,15096321-15096426 Length = 908 Score = 29.5 bits (63), Expect = 2.8 Identities = 22/85 (25%), Positives = 36/85 (42%) Frame = -3 Query: 695 RTCHSAQETPWRGAHSIAGWYVAKKISGNALWMTAVAPGSMDELYSGGGRCDGKNEMPVS 516 R+ H ++ P H+I AKK SGN ++ + ++L K Sbjct: 573 RSSHRTKKGPCLYPHAIVP---AKKYSGNEYTLSYLKSSPAEQLPVAVSSVQVKRSTDDP 629 Query: 515 CIFKILPCKM*TNCQVNFFMLKTIK 441 K LPC++ T C ++ LK I+ Sbjct: 630 LDTKTLPCEVKTGCTLSPIQLKHIQ 654 >04_02_0036 - 9033411-9033746,9033961-9034032,9034122-9034222, 9034309-9034530,9034832-9034913,9035029-9035214, 9035311-9035445,9035543-9035641 Length = 410 Score = 29.5 bits (63), Expect = 2.8 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +1 Query: 139 PRVTFLLDISECPKCHSSVFLDEYK 213 PR T+++ + +CP H + LDE K Sbjct: 219 PRTTYIIALKDCPGTHEFLLLDEGK 243 >09_02_0250 + 6266818-6267029,6267230-6267287,6267999-6268118, 6272359-6272511,6273381-6273586,6274280-6274733, 6276573-6276610,6276923-6277046,6277184-6277246, 6277350-6277412,6277526-6278152,6278267-6278294, 6278373-6278413,6278689-6278851,6278987-6279039, 6279217-6279262,6279373-6279444,6279578-6279741, 6279968-6280099,6280249-6280565,6280721-6280892, 6281009-6281107,6281275-6281349,6281446-6281504, 6281647-6281836,6281982-6282020 Length = 1255 Score = 27.9 bits (59), Expect = 8.5 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -2 Query: 123 QSNTSVAIETTRTTKHSCLLSVT*TFFRISVSYF 22 + N++V +E + K +CL +F R S YF Sbjct: 486 KKNSNVLLENQKMKKQTCLTKANSSFSRFSAKYF 519 >07_01_0464 - 3504264-3504475,3504842-3505031,3505310-3505408, 3505561-3505653,3505926-3506891,3507267-3507485, 3508038-3508247,3508371-3508630,3508956-3510737, 3510796-3511009 Length = 1414 Score = 27.9 bits (59), Expect = 8.5 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = -3 Query: 170 SEMSNRKVTRGCCWHFNRIRPLQ*KPQERQNTVAFSLL 57 SE S V R C +R++PL+ + QE+Q TV++ L Sbjct: 1177 SESSCEAVHRACNILVDRLKPLKEQLQEKQGTVSWDEL 1214 >01_06_1100 + 34530132-34530485,34530544-34530705 Length = 171 Score = 27.9 bits (59), Expect = 8.5 Identities = 13/43 (30%), Positives = 23/43 (53%) Frame = +2 Query: 545 TARHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVF 673 +A+H H L+ L+ T + + + + L+NEL ST+F Sbjct: 105 SAKHLDTAHSVVLKELKKPTGQQEARDVTNQLELFNELKSTLF 147 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,165,754 Number of Sequences: 37544 Number of extensions: 426523 Number of successful extensions: 958 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 938 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 958 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1862792824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -