BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10e16 (718 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) 39 0.004 SB_14729| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) 38 0.006 SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_14726| Best HMM Match : Ribosomal_L30 (HMM E-Value=6.6) 38 0.008 SB_51961| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_48112| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.019 SB_17278| Best HMM Match : RVT_1 (HMM E-Value=0.0082) 37 0.019 SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) 37 0.019 SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) 37 0.019 SB_51257| Best HMM Match : Pox_F16 (HMM E-Value=4.1) 36 0.025 SB_33578| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00076) 36 0.025 SB_26110| Best HMM Match : HipA_C (HMM E-Value=5.5) 36 0.025 SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) 36 0.025 SB_25119| Best HMM Match : Ribosomal_S27 (HMM E-Value=9.4) 36 0.043 SB_47667| Best HMM Match : Ldl_recept_a (HMM E-Value=0) 35 0.057 SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.076 SB_31373| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) 35 0.076 SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.076 SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.076 SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) 35 0.076 SB_43828| Best HMM Match : XPG_N (HMM E-Value=1.8) 34 0.10 SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) 34 0.10 SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) 34 0.10 SB_7946| Best HMM Match : DUF434 (HMM E-Value=7.5) 34 0.10 SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) 34 0.10 SB_4935| Best HMM Match : Pox_F16 (HMM E-Value=5.3) 34 0.10 SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) 34 0.10 SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) 34 0.10 SB_40765| Best HMM Match : DX (HMM E-Value=1.4) 34 0.10 SB_33076| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) 34 0.10 SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) 34 0.10 SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_20783| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_31120| Best HMM Match : Pox_F16 (HMM E-Value=5) 33 0.23 SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_37654| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.53 SB_16492| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.53 SB_30049| Best HMM Match : FBA_2 (HMM E-Value=7) 31 0.71 SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.71 SB_19530| Best HMM Match : EMI (HMM E-Value=3.5) 31 0.71 SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) 31 0.71 SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) 31 0.71 SB_58762| Best HMM Match : VWC (HMM E-Value=2.8e-06) 31 1.2 SB_25588| Best HMM Match : PAE (HMM E-Value=1.5e-31) 31 1.2 SB_32643| Best HMM Match : Carla_C4 (HMM E-Value=9.9) 29 3.8 SB_22775| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_19305| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_53803| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.0 SB_16967| Best HMM Match : Laminin_EGF (HMM E-Value=0) 29 5.0 SB_58576| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_56220| Best HMM Match : RVT_1 (HMM E-Value=3.7e-16) 28 6.6 SB_48902| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_40983| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_40552| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_38731| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_34180| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0) 28 6.6 SB_33284| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_30890| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_29924| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) 28 6.6 SB_24244| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_22251| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_36764| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_36762| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_29800| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_24298| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_14496| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_378| Best HMM Match : TTL (HMM E-Value=1.8) 28 6.6 SB_49160| Best HMM Match : IBR (HMM E-Value=2.5e-15) 28 8.7 SB_43044| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) 28 8.7 SB_2368| Best HMM Match : Patched (HMM E-Value=8.6e-08) 28 8.7 >SB_58989| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 885 Score = 39.1 bits (87), Expect = 0.004 Identities = 20/51 (39%), Positives = 25/51 (49%) Frame = +2 Query: 551 RHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFK 703 R R HP PL +S+ SF RTI WN LP+ +F E + FK Sbjct: 823 RKTRRSHPESFIPLSTSSASEHLSFFSRTIIQWNNLPALLFNEPCSLPIFK 873 >SB_14729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 315 Score = 38.7 bits (86), Expect = 0.005 Identities = 22/60 (36%), Positives = 31/60 (51%) Frame = +2 Query: 491 YKAIS*KYMIPASRFYHRTARHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 670 Y I YM+ R+ R R YY + L+++T+ F SF R IR+WN LP+ V Sbjct: 228 YNFIIVLYMLNLPDLVTRSTRSTRRKELYYNQ-LQANTLAFNYSFFARAIRIWNLLPNDV 286 >SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 2075 Score = 38.3 bits (85), Expect = 0.006 Identities = 21/51 (41%), Positives = 27/51 (52%) Frame = +2 Query: 560 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGL 712 SR H L+++ + F SF PRTIR WN LP+ V D+ FK L Sbjct: 1627 SRRHSRTYHQLQANILAFNYSFFPRTIRTWNLLPAEVV-NAADLPSFKSAL 1676 >SB_43973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3142 Score = 38.3 bits (85), Expect = 0.006 Identities = 21/51 (41%), Positives = 27/51 (52%) Frame = +2 Query: 560 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGL 712 SR H L+++ + F SF PRTIR WN LP+ V D+ FK L Sbjct: 1073 SRRHSRTYHQLQANILAFNYSFFPRTIRTWNLLPAEVV-NAADLPSFKSAL 1122 >SB_14726| Best HMM Match : Ribosomal_L30 (HMM E-Value=6.6) Length = 231 Score = 37.9 bits (84), Expect = 0.008 Identities = 19/48 (39%), Positives = 25/48 (52%) Frame = +2 Query: 569 HPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGL 712 H + L + T ++ SFLPR +RLWN LP +V R F GL Sbjct: 184 HSEFYTILNARTDIYKYSFLPRALRLWNNLPQSVIDMRGCPEAFHSGL 231 >SB_51961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +2 Query: 560 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 670 +R H + L+S+ + + SF PR IR+WN LPS V Sbjct: 122 TRRHNHSFLQLQSNILSYNYSFFPRAIRIWNLLPSNV 158 >SB_48112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 232 Score = 36.7 bits (81), Expect = 0.019 Identities = 20/52 (38%), Positives = 28/52 (53%) Frame = +2 Query: 557 RSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGL 712 R++ +Y P + T ++ SFLPR +RLWN LP +V R F GL Sbjct: 182 RTQHSEFYTIP-NARTDIYKYSFLPRALRLWNNLPQSVIDMRGCPEAFHAGL 232 >SB_17278| Best HMM Match : RVT_1 (HMM E-Value=0.0082) Length = 506 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +2 Query: 560 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 670 +R H + L+S+ + + SF PR IR+WN LPS V Sbjct: 441 TRRHNHSFLQLQSNILSYNYSFFPRAIRIWNLLPSNV 477 >SB_11764| Best HMM Match : DSHCT (HMM E-Value=1.9e-27) Length = 1492 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +2 Query: 560 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 670 +R H + L+S+ + + SF PR IR+WN LPS V Sbjct: 1427 TRRHNHSFLQLQSNILSYNYSFFPRAIRIWNLLPSNV 1463 >SB_10927| Best HMM Match : RVT_1 (HMM E-Value=6.6e-39) Length = 452 Score = 36.7 bits (81), Expect = 0.019 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +2 Query: 560 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 670 +R H + L+S+ + + SF PR IR+WN LPS V Sbjct: 387 TRRHNHSFLQLQSNILSYNYSFFPRAIRIWNLLPSNV 423 >SB_51257| Best HMM Match : Pox_F16 (HMM E-Value=4.1) Length = 243 Score = 36.3 bits (80), Expect = 0.025 Identities = 17/38 (44%), Positives = 22/38 (57%) Frame = +2 Query: 557 RSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 670 RSR + ++S+ + SF PRTIR WN LPS V Sbjct: 177 RSRTNSSKYNQIQSNVLSHSYSFFPRTIRTWNLLPSEV 214 >SB_33578| Best HMM Match : Exo_endo_phos (HMM E-Value=0.00076) Length = 888 Score = 36.3 bits (80), Expect = 0.025 Identities = 20/56 (35%), Positives = 26/56 (46%) Frame = +2 Query: 518 IPASRFYHRTARHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERY 685 +P S R HP + + + T F+ SF+PR IRLWN L TV Y Sbjct: 713 LPLSTLSKPLRRSERTSHPEHYDIPYARTNIFKYSFVPRAIRLWNSLEVTVVLAAY 768 >SB_26110| Best HMM Match : HipA_C (HMM E-Value=5.5) Length = 210 Score = 36.3 bits (80), Expect = 0.025 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = +2 Query: 542 RTARHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 670 R+ R R YY + L+++T+ F SF R IR+WN LP+ V Sbjct: 140 RSTRSTRRKELYYNQ-LQANTLAFNYSFFARAIRIWNLLPNDV 181 >SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 36.3 bits (80), Expect = 0.025 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = +2 Query: 542 RTARHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 670 R+ R R YY + L+++T+ F SF R IR+WN LP+ V Sbjct: 294 RSTRSTRRKELYYNQ-LQANTLAFNYSFFARAIRIWNLLPNDV 335 >SB_4310| Best HMM Match : RVT_1 (HMM E-Value=5e-28) Length = 570 Score = 36.3 bits (80), Expect = 0.025 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = +2 Query: 542 RTARHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 670 R+ R R YY + L+++T+ F SF R IR+WN LP+ V Sbjct: 500 RSTRSTRRKELYYNQ-LQANTLAFNYSFFARAIRIWNLLPNDV 541 >SB_25119| Best HMM Match : Ribosomal_S27 (HMM E-Value=9.4) Length = 443 Score = 35.5 bits (78), Expect = 0.043 Identities = 15/37 (40%), Positives = 20/37 (54%) Frame = +2 Query: 560 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 670 +R H + L S+ + F SF PR IR WN LP + Sbjct: 262 TRRHSLSFQQLHSNILSFNYSFFPRAIRAWNLLPDNI 298 >SB_47667| Best HMM Match : Ldl_recept_a (HMM E-Value=0) Length = 3891 Score = 35.1 bits (77), Expect = 0.057 Identities = 14/29 (48%), Positives = 17/29 (58%) Frame = +3 Query: 627 CHVPSGYGMSSPPRCFLSAMTCPSSNEAC 713 C P GY + +P RC LS +C SS AC Sbjct: 2147 CSCPQGYRLENPYRCVLSNASCASSEFAC 2175 Score = 29.9 bits (64), Expect = 2.2 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 591 CGHPQCVSRDLFCHVPSGYGMSSPPRCFLSAMTCPSSNEAC 713 C +C+SRD C + G SS + +TCP+ C Sbjct: 3053 CPSGRCISRDWLCDGDNDCGDSSDEKAGECHVTCPAGQARC 3093 >SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 918 Score = 34.7 bits (76), Expect = 0.076 Identities = 19/48 (39%), Positives = 25/48 (52%) Frame = +2 Query: 560 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFK 703 SR + ++S+ + SF PRTIR WN LPS V E + FK Sbjct: 853 SRTNSSKYNQIQSNVLSHSYSFFPRTIRTWNLLPSEVI-ESSSIDSFK 899 >SB_31373| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) Length = 198 Score = 34.7 bits (76), Expect = 0.076 Identities = 19/48 (39%), Positives = 25/48 (52%) Frame = +2 Query: 560 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFK 703 SR + ++S+ + SF PRTIR WN LPS V E + FK Sbjct: 133 SRTNSSKYNQIQSNVLSHSYSFFPRTIRTWNLLPSEVI-ESSSIDSFK 179 >SB_40344| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 401 Score = 34.7 bits (76), Expect = 0.076 Identities = 20/57 (35%), Positives = 26/57 (45%) Frame = +2 Query: 491 YKAIS*KYMIPASRFYHRTARHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELP 661 YKA++ K + R R HP L T F+ SF RTI+ WN+LP Sbjct: 328 YKAVNKKSALKIPDNIDRRTRQLRSSHPDKFIELCPRTEAFKNSFFCRTIKEWNKLP 384 >SB_30407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 788 Score = 34.7 bits (76), Expect = 0.076 Identities = 19/48 (39%), Positives = 25/48 (52%) Frame = +2 Query: 560 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFK 703 SR + ++S+ + SF PRTIR WN LPS V E + FK Sbjct: 544 SRTNSSKYNQIQSNVLSHSYSFFPRTIRTWNLLPSEVI-ESSSIDSFK 590 >SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) Length = 837 Score = 34.7 bits (76), Expect = 0.076 Identities = 19/48 (39%), Positives = 25/48 (52%) Frame = +2 Query: 560 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFK 703 SR + ++S+ + SF PRTIR WN LPS V E + FK Sbjct: 772 SRTNSSKYNQIQSNVLSHSYSFFPRTIRTWNLLPSEVI-ESSSIDSFK 818 >SB_43828| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 174 Score = 34.3 bits (75), Expect = 0.10 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = +2 Query: 539 HRTARHR-SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGL 712 H+ R R S YY E +++ ++ SF PRTIR WN LP+ + E + FKR L Sbjct: 110 HQDLRTRNSHNFKYYQE--KATKNKYFYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDL 165 >SB_26135| Best HMM Match : RVT_1 (HMM E-Value=0.072) Length = 375 Score = 34.3 bits (75), Expect = 0.10 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = +2 Query: 539 HRTARHR-SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGL 712 H+ R R S YY E +++ ++ SF PRTIR WN LP+ + E + FKR L Sbjct: 311 HQDLRTRNSHNFKYYQE--KATKNKYFYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDL 366 >SB_19117| Best HMM Match : XPG_N (HMM E-Value=1.8) Length = 361 Score = 34.3 bits (75), Expect = 0.10 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = +2 Query: 539 HRTARHR-SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGL 712 H+ R R S YY E +++ ++ SF PRTIR WN LP+ + E + FKR L Sbjct: 297 HQDLRTRNSHNFKYYQE--KATKNKYFYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDL 352 >SB_7946| Best HMM Match : DUF434 (HMM E-Value=7.5) Length = 294 Score = 34.3 bits (75), Expect = 0.10 Identities = 19/57 (33%), Positives = 27/57 (47%) Frame = +2 Query: 491 YKAIS*KYMIPASRFYHRTARHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELP 661 YKA++ K + R R HP L +T ++ SF RTI+ WN+LP Sbjct: 219 YKAVNKKSALEIPDNIDRRTRQLRSSHPDKFIELCPTTEAYKNSFFCRTIKEWNKLP 275 >SB_6030| Best HMM Match : rve (HMM E-Value=8.7e-30) Length = 1280 Score = 34.3 bits (75), Expect = 0.10 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +2 Query: 578 YLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 670 Y L+++T+ F SF R IR+WN LP+ V Sbjct: 1221 YCNQLQANTLTFNYSFFARAIRIWNLLPNDV 1251 >SB_4935| Best HMM Match : Pox_F16 (HMM E-Value=5.3) Length = 243 Score = 34.3 bits (75), Expect = 0.10 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +2 Query: 560 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 670 SR + ++S+ + SF PRTIR WN LPS V Sbjct: 178 SRTNSSKYNQIQSNVLSHSYSFFPRTIRTWNLLPSEV 214 >SB_43541| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 581 Score = 34.3 bits (75), Expect = 0.10 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = +2 Query: 539 HRTARHR-SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGL 712 H+ R R S YY E +++ ++ SF PRTIR WN LP+ + E + FKR L Sbjct: 517 HQDLRTRNSHNFKYYQE--KATKNKYFYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDL 572 >SB_42891| Best HMM Match : DUF537 (HMM E-Value=1.2e-23) Length = 2386 Score = 34.3 bits (75), Expect = 0.10 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +2 Query: 560 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 670 SR + ++S+ + SF PRTIR WN LPS V Sbjct: 440 SRTNSSKYNQIQSNVLSHSYSFFPRTIRTWNLLPSEV 476 >SB_40765| Best HMM Match : DX (HMM E-Value=1.4) Length = 278 Score = 34.3 bits (75), Expect = 0.10 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = +2 Query: 539 HRTARHR-SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGL 712 H+ R R S YY E +++ ++ SF PRTIR WN LP+ + E + FKR L Sbjct: 214 HQDLRTRNSHNFKYYQE--KATKNKYFYSFFPRTIRHWNTLPNELV-ELDSIEHFKRDL 269 >SB_33076| Best HMM Match : Put_DNA-bind_N (HMM E-Value=8.4) Length = 152 Score = 34.3 bits (75), Expect = 0.10 Identities = 16/37 (43%), Positives = 21/37 (56%) Frame = +2 Query: 560 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 670 SR + ++S+ + SF PRTIR WN LPS V Sbjct: 87 SRTNSSKYNQIQSNVLSHSYSFFPRTIRTWNLLPSEV 123 >SB_20120| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 666 Score = 34.3 bits (75), Expect = 0.10 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = +2 Query: 539 HRTARHR-SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGL 712 H+ R R S YY E +++ ++ SF PRTIR WN LP+ + E + FKR L Sbjct: 602 HQDLRTRNSHNFKYYQE--KATKNKYFYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDL 657 >SB_54752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 792 Score = 33.5 bits (73), Expect = 0.18 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +2 Query: 524 ASRFYHRTARHRSR-VHPYYLEPLRSSTVRFQR-SFLPRTIRLWNELPS 664 AS T+R+ +R HP + + R S+ PRT++LWN LPS Sbjct: 715 ASLLSPATSRYNTRSYHPNNYRLFSTHNQNYYRNSYFPRTVKLWNSLPS 763 >SB_20783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 33.5 bits (73), Expect = 0.18 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +2 Query: 524 ASRFYHRTARHRSR-VHPYYLEPLRSSTVRFQR-SFLPRTIRLWNELPS 664 AS T+R+ +R HP + + R S+ PRT++LWN LPS Sbjct: 218 ASLLSPATSRYNTRSYHPNNYRLFSTHNQNYYRNSYFPRTVKLWNSLPS 266 >SB_31120| Best HMM Match : Pox_F16 (HMM E-Value=5) Length = 284 Score = 33.1 bits (72), Expect = 0.23 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +2 Query: 560 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTV 670 SR + ++S+ + SF PRTIR WN LP+ V Sbjct: 219 SRTNSSKYNQIQSNVLSHSYSFFPRTIRTWNLLPAQV 255 >SB_38808| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 824 Score = 33.1 bits (72), Expect = 0.23 Identities = 20/58 (34%), Positives = 31/58 (53%) Frame = +2 Query: 539 HRTARHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFPERYDMSFFKRGL 712 H+ R R+ H + +++ ++ SF PRTIR WN LP+ + E + FKR L Sbjct: 760 HQDLRTRNS-HNFKCYQEKATKNKYFYSFFPRTIRHWNTLPNELV-ELGSIEHFKRDL 815 >SB_37654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 865 Score = 31.9 bits (69), Expect = 0.53 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +2 Query: 560 SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPSTVFP 676 S + Y L + F SF RTI +WN LP VFP Sbjct: 809 SACNSYQFSLLPAKINAFLFSFYSRTIPVWNALPQAVFP 847 >SB_16492| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 295 Score = 31.9 bits (69), Expect = 0.53 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = +2 Query: 611 FQRSFLPRTIRLWNELPS 664 ++ S+ PRT++LWN LPS Sbjct: 249 YRNSYFPRTVKLWNSLPS 266 >SB_30049| Best HMM Match : FBA_2 (HMM E-Value=7) Length = 282 Score = 31.5 bits (68), Expect = 0.71 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +2 Query: 590 LRSSTVRFQRSFLPRTIRLWNELPSTV 670 L+S+ + + SF R IR+WN LPS V Sbjct: 227 LQSNILSYNYSFFARAIRIWNLLPSNV 253 >SB_24816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 662 Score = 31.5 bits (68), Expect = 0.71 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +2 Query: 569 HPYYLEPLRSSTVRFQRSFLPRTIRLWNELP-STV 670 HP + T F+ SF P IR+WN LP ST+ Sbjct: 616 HPQRFALVSCKTNVFKESFFPHAIRMWNGLPVSTI 650 >SB_19530| Best HMM Match : EMI (HMM E-Value=3.5) Length = 244 Score = 31.5 bits (68), Expect = 0.71 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 1/35 (2%) Frame = +2 Query: 569 HPYYLEPLRSSTVRFQRSFLPRTIRLWNELP-STV 670 HP + T F+ SF P IR+WN LP ST+ Sbjct: 198 HPQRFALVSCKTNVFKESFFPHAIRMWNGLPVSTI 232 >SB_2897| Best HMM Match : RVT_1 (HMM E-Value=3e-33) Length = 609 Score = 31.5 bits (68), Expect = 0.71 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = +2 Query: 539 HRTARHR-SRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELPS 664 H+ R R S YY E +++ ++ SF PRTIR WN LP+ Sbjct: 543 HQDLRTRNSHNFKYYQE--KATKNKYFYSFFPRTIRHWNTLPN 583 >SB_19427| Best HMM Match : RVT_1 (HMM E-Value=7.5e-32) Length = 698 Score = 31.5 bits (68), Expect = 0.71 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 1/58 (1%) Frame = +2 Query: 491 YKAIS*KYMIPA-SRFYHRTARHRSRVHPYYLEPLRSSTVRFQRSFLPRTIRLWNELP 661 YKA++ K + RT + RS + ++E L T ++ SF RTI+ WN+LP Sbjct: 625 YKAVNKKSALKIPDNIDRRTRQLRSSLPDKFIE-LCPRTEAYKNSFFCRTIKEWNKLP 681 >SB_58762| Best HMM Match : VWC (HMM E-Value=2.8e-06) Length = 218 Score = 30.7 bits (66), Expect = 1.2 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 1/55 (1%) Frame = +1 Query: 22 EVTDAYSKKCSCNREKATVFCRSCGFYCNGRIRLKCQQHPRVTFLLDISE-CPKC 183 +V DA +KC CN KA+ C S G++C+ + C++ ++L+ + CP C Sbjct: 98 DVKDAACQKCECNSGKAS-SC-SIGYHCDALLDGACEK-----YVLEPKQCCPTC 145 >SB_25588| Best HMM Match : PAE (HMM E-Value=1.5e-31) Length = 996 Score = 30.7 bits (66), Expect = 1.2 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 8/45 (17%) Frame = +1 Query: 40 SKKCSCNREKATVFC--------RSCGFYCNGRIRLKCQQHPRVT 150 + CSC +KA C RSCG C+ + C QH +VT Sbjct: 841 ASSCSCMCDKAPEVCPVGKYWSQRSCGCVCSAHVVGACNQHGKVT 885 >SB_32643| Best HMM Match : Carla_C4 (HMM E-Value=9.9) Length = 159 Score = 29.1 bits (62), Expect = 3.8 Identities = 20/64 (31%), Positives = 28/64 (43%) Frame = +2 Query: 461 KSLLGNLFTSYKAIS*KYMIPASRFYHRTARHRSRVHPYYLEPLRSSTVRFQRSFLPRTI 640 + L+ L YK + IP R R Y + L+++ F SF+PRTI Sbjct: 62 RRLMLQLSMFYKIKNNIVKIPFPTSIQENTRTSRRTDISYRQ-LQANVNAFGMSFIPRTI 120 Query: 641 RLWN 652 R WN Sbjct: 121 RTWN 124 >SB_22775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.1 bits (62), Expect = 3.8 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 590 LRSSTVRFQRSFLPRTIRLWN 652 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFDMSFIPRTIRTWN 124 >SB_19305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.1 bits (62), Expect = 3.8 Identities = 20/64 (31%), Positives = 28/64 (43%) Frame = +2 Query: 461 KSLLGNLFTSYKAIS*KYMIPASRFYHRTARHRSRVHPYYLEPLRSSTVRFQRSFLPRTI 640 + L+ L YK + IP R R Y + L+++ F SF+PRTI Sbjct: 62 RRLMLQLSMFYKIKNNIVKIPFPTSIQENTRTSRRTDISYRQ-LQANVNAFGMSFIPRTI 120 Query: 641 RLWN 652 R WN Sbjct: 121 RTWN 124 >SB_53803| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 619 Score = 28.7 bits (61), Expect = 5.0 Identities = 15/49 (30%), Positives = 21/49 (42%) Frame = +3 Query: 570 IHTTWSHCGHPQCVSRDLFCHVPSGYGMSSPPRCFLSAMTCPSSNEACG 716 IH+T CG PQC C + S P+C + + C + CG Sbjct: 425 IHST--QCGSPQCGIHSTQCGIHSTQCGIHSPQCGIHSPQCGIHSTQCG 471 >SB_16967| Best HMM Match : Laminin_EGF (HMM E-Value=0) Length = 1706 Score = 28.7 bits (61), Expect = 5.0 Identities = 18/76 (23%), Positives = 37/76 (48%), Gaps = 4/76 (5%) Frame = +1 Query: 37 YSKKCSCNREKATVFCRSCGFYCNGRIRLKCQQHP--RVTFLLDISECPKCHSSVFLD-- 204 YS C++ C + + G++ +C+++ + L D ECP C++ + D Sbjct: 1075 YSNTSVCDQTTGQCSCNAT-LHIGGQLCDRCEENAYNKSDSLFDCHECPSCYAYIQTDVR 1133 Query: 205 EYKTGPS*LQQVSITI 252 + +T + LQ ++ TI Sbjct: 1134 QIRTVVARLQALTYTI 1149 >SB_58576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 590 LRSSTVRFQRSFLPRTIRLWN 652 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_56220| Best HMM Match : RVT_1 (HMM E-Value=3.7e-16) Length = 453 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 590 LRSSTVRFQRSFLPRTIRLWN 652 L+++ F SF+PRTIR WN Sbjct: 398 LQANVNAFGMSFIPRTIRTWN 418 >SB_48902| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 590 LRSSTVRFQRSFLPRTIRLWN 652 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_40983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 590 LRSSTVRFQRSFLPRTIRLWN 652 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_40552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 590 LRSSTVRFQRSFLPRTIRLWN 652 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_38731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 590 LRSSTVRFQRSFLPRTIRLWN 652 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_34180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 590 LRSSTVRFQRSFLPRTIRLWN 652 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_34116| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 522 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 590 LRSSTVRFQRSFLPRTIRLWN 652 L+++ F SF+PRTIR WN Sbjct: 467 LQANVNAFGMSFIPRTIRTWN 487 >SB_33284| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 263 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 590 LRSSTVRFQRSFLPRTIRLWN 652 L+++ F SF+PRTIR WN Sbjct: 208 LQANVNAFGMSFIPRTIRTWN 228 >SB_30890| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 590 LRSSTVRFQRSFLPRTIRLWN 652 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_29924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 590 LRSSTVRFQRSFLPRTIRLWN 652 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_28979| Best HMM Match : RVT_1 (HMM E-Value=1.6e-40) Length = 892 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 590 LRSSTVRFQRSFLPRTIRLWN 652 L+++ F SF+PRTIR WN Sbjct: 837 LQANVNAFGMSFIPRTIRTWN 857 >SB_24244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 590 LRSSTVRFQRSFLPRTIRLWN 652 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_22251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 497 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 590 LRSSTVRFQRSFLPRTIRLWN 652 L+++ F SF+PRTIR WN Sbjct: 442 LQANVNAFGMSFIPRTIRTWN 462 >SB_36764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 590 LRSSTVRFQRSFLPRTIRLWN 652 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_36762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 590 LRSSTVRFQRSFLPRTIRLWN 652 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_29800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 590 LRSSTVRFQRSFLPRTIRLWN 652 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_24298| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 590 LRSSTVRFQRSFLPRTIRLWN 652 L+++ F SF+PRTIR WN Sbjct: 104 LQANVNAFGMSFIPRTIRTWN 124 >SB_14496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 28.3 bits (60), Expect = 6.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +2 Query: 590 LRSSTVRFQRSFLPRTIRLWN 652 L+++ F SF+PRTIR WN Sbjct: 55 LQANVNAFGMSFIPRTIRTWN 75 >SB_378| Best HMM Match : TTL (HMM E-Value=1.8) Length = 327 Score = 28.3 bits (60), Expect = 6.6 Identities = 17/44 (38%), Positives = 27/44 (61%), Gaps = 1/44 (2%) Frame = +1 Query: 361 NQKSQLSIDNK*LKFIQSA-IFLT*QYIFIVLSIKKFTWQFVYI 489 NQK +S+ + F++ A IFL YI ++L+ ++FTW F I Sbjct: 66 NQKLDMSLLDVISSFLEDAPIFLLQTYI-VLLTRREFTWTFAEI 108 >SB_49160| Best HMM Match : IBR (HMM E-Value=2.5e-15) Length = 582 Score = 27.9 bits (59), Expect = 8.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +1 Query: 160 DISECPKCHSSVFLDE 207 DI CP+CHS+V DE Sbjct: 405 DIYYCPRCHSAVVADE 420 >SB_43044| Best HMM Match : zf-C2H2 (HMM E-Value=0.83) Length = 226 Score = 27.9 bits (59), Expect = 8.7 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 5/32 (15%) Frame = +1 Query: 64 EKATVFCRSCGFYCNGRIRL-----KCQQHPR 144 + + + CRSCG C RIRL KCQ+ R Sbjct: 195 QTSVLVCRSCGRTCASRIRLFSHGKKCQRSSR 226 >SB_2368| Best HMM Match : Patched (HMM E-Value=8.6e-08) Length = 1420 Score = 27.9 bits (59), Expect = 8.7 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = -3 Query: 587 APGSMDELYSGGGRCDGKNEMPVS 516 AP S+++ GGG C G+N +PV+ Sbjct: 770 APTSLEDFKWGGGPCLGENGVPVN 793 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,611,576 Number of Sequences: 59808 Number of extensions: 509392 Number of successful extensions: 1478 Number of sequences better than 10.0: 74 Number of HSP's better than 10.0 without gapping: 1382 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1475 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1901817086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -