BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10e15 (692 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-2|CAD29631.1| 208|Anopheles gambiae hypothetical prote... 25 2.3 AJ439398-1|CAD28124.1| 208|Anopheles gambiae hypothetical prote... 25 2.3 AJ439061-1|CAD27770.1| 89|Anopheles gambiae hypothetical prote... 25 2.3 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 25 3.0 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 23 9.1 >AJ441131-2|CAD29631.1| 208|Anopheles gambiae hypothetical protein protein. Length = 208 Score = 25.0 bits (52), Expect = 2.3 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = -2 Query: 121 RSTSHVESTIFYFCFTINTSLAVRSGYVGTAFSVHGVNTT 2 R SH +S++ C NT+ Y+ F+ H + T Sbjct: 36 RQGSHAKSSVHKLCHARNTTQPRTRWYIPAFFAAHPTDRT 75 >AJ439398-1|CAD28124.1| 208|Anopheles gambiae hypothetical protein protein. Length = 208 Score = 25.0 bits (52), Expect = 2.3 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = -2 Query: 121 RSTSHVESTIFYFCFTINTSLAVRSGYVGTAFSVHGVNTT 2 R SH +S++ C NT+ Y+ F+ H + T Sbjct: 36 RQGSHAKSSVHKLCHAKNTTRPRTRWYIPAFFAAHPTDRT 75 >AJ439061-1|CAD27770.1| 89|Anopheles gambiae hypothetical protein protein. Length = 89 Score = 25.0 bits (52), Expect = 2.3 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = -2 Query: 121 RSTSHVESTIFYFCFTINTSLAVRSGYVGTAFSVHGVNTT 2 R SH +S++ C NT+ Y+ F+ H + T Sbjct: 36 RQGSHAKSSVHKLCHAKNTTRPRTRWYIPAFFAAHPTDRT 75 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 24.6 bits (51), Expect = 3.0 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 Query: 451 IHNALLDALAVGEEEDANHHLHN 383 IH+ALL+A+ G E LHN Sbjct: 924 IHDALLEAVICGSTEVPARSLHN 946 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 23.0 bits (47), Expect = 9.1 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = -2 Query: 436 LDALAVGEEEDANHHLHNDDHQQEDCVRDDHAV 338 L+ ++ED + +DD + EDC + H + Sbjct: 1190 LNGAGNNDDEDEDDD-EDDDDEDEDCADEQHPI 1221 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 632,684 Number of Sequences: 2352 Number of extensions: 12495 Number of successful extensions: 29 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70250040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -