BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10e14 (508 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29635| Best HMM Match : E-MAP-115 (HMM E-Value=1.2) 28 3.8 SB_51974| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.7 >SB_29635| Best HMM Match : E-MAP-115 (HMM E-Value=1.2) Length = 2658 Score = 28.3 bits (60), Expect = 3.8 Identities = 15/48 (31%), Positives = 28/48 (58%) Frame = -2 Query: 261 CLRLKNRHSFSFLNVKRRFLNCSKTADVNGLRDIYFTSITLLSAPTMS 118 CL++ + + S ++ + RF++ K +V+ +Y T +TLLS T S Sbjct: 1211 CLKILSANKKSEID-RNRFMDLKKFTNVSATSQLYDTLLTLLSEMTPS 1257 >SB_51974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3474 Score = 27.5 bits (58), Expect = 6.7 Identities = 18/36 (50%), Positives = 22/36 (61%) Frame = +1 Query: 283 WLP*LSVEVTLEIFTSKPRSKLILNEVHSVPTVRTK 390 WL + + VT++IF SKP S LIL V V VR K Sbjct: 2450 WLISMVMAVTVDIFVSKPLS-LILLVVFLVLLVRRK 2484 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,500,489 Number of Sequences: 59808 Number of extensions: 268204 Number of successful extensions: 556 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 531 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 556 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1111677931 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -