BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10e13 (492 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. 25 1.4 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 24 3.2 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 22 9.9 >AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. Length = 603 Score = 25.0 bits (52), Expect = 1.4 Identities = 14/48 (29%), Positives = 21/48 (43%) Frame = -2 Query: 410 SICIDTMCLPGTMTRPNTLGSSVSPSLFFKYSEQAPKITFASLSVHRN 267 ++ + T+C+PGT L S K S APK L + +N Sbjct: 555 TLAMSTLCIPGTSVPCERLFSKAGQIYSEKRSRLAPKKLQEILFIQQN 602 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 23.8 bits (49), Expect = 3.2 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = -2 Query: 251 LPSVISILNFIFNHFLSFAFPSSSTT*GASEVVLLPSLLISLACSNLY 108 LP + S+ + NH S P SST+ S P ++S A S ++ Sbjct: 223 LPLIRSLADIGKNHSSSKNMPRSSTSKSISSANSFPMHVVSSAPSGMH 270 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 22.2 bits (45), Expect = 9.9 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -2 Query: 281 SVHRNTPIRTLPSVISIL 228 S+HRN +T P + +L Sbjct: 1341 SIHRNNNFQTFPQAVLVL 1358 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 455,893 Number of Sequences: 2352 Number of extensions: 8187 Number of successful extensions: 20 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43554477 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -