BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10e09 (586 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY330174-1|AAQ16280.1| 178|Anopheles gambiae odorant-binding pr... 23 5.5 AJ618918-1|CAF01997.1| 228|Anopheles gambiae putative odorant-b... 23 5.5 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 23 7.3 >AY330174-1|AAQ16280.1| 178|Anopheles gambiae odorant-binding protein AgamOBP47 protein. Length = 178 Score = 23.4 bits (48), Expect = 5.5 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 333 CVTLPWAPAHTFGIRHSPFAGQAAHYAAPEGIP 431 CVT F HS + GQ A EGIP Sbjct: 24 CVTPFLVEPSAFMTCHSKWIGQTKRQMAMEGIP 56 >AJ618918-1|CAF01997.1| 228|Anopheles gambiae putative odorant-binding protein OBPjj2 protein. Length = 228 Score = 23.4 bits (48), Expect = 5.5 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 333 CVTLPWAPAHTFGIRHSPFAGQAAHYAAPEGIP 431 CVT F HS + GQ A EGIP Sbjct: 74 CVTPFLVEPSAFMTCHSKWIGQTKRQMAMEGIP 106 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 23.0 bits (47), Expect = 7.3 Identities = 13/49 (26%), Positives = 24/49 (48%) Frame = +1 Query: 343 CPGRRHIHLEFDTLRSPAKQLTTQHLKGSLLSNINLSVIRPIIVINIMF 489 C G + T+ +PAK+LT G L S+ + S + ++ +M+ Sbjct: 48 CYGGGGANSRLVTVPAPAKELTDSSRSGGLPSSSSSSSLSCLLATIVMW 96 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 555,615 Number of Sequences: 2352 Number of extensions: 10865 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55927431 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -