BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10e08 (586 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z49993-1|CAA90290.1| 397|Homo sapiens proteinase-activated rece... 29 9.1 U36753-1|AAA90957.1| 369|Homo sapiens protease-activated recept... 29 9.1 BT009856-1|AAP88858.1| 397|Homo sapiens coagulation factor II (... 29 9.1 BC018130-1|AAH18130.1| 397|Homo sapiens coagulation factor II (... 29 9.1 BC012453-1|AAH12453.1| 397|Homo sapiens coagulation factor II (... 29 9.1 AY336105-1|AAP97012.1| 397|Homo sapiens protease-activated rece... 29 9.1 AF400075-1|AAK77914.1| 397|Homo sapiens coagulation factor II (... 29 9.1 >Z49993-1|CAA90290.1| 397|Homo sapiens proteinase-activated receptor 2 protein. Length = 397 Score = 29.5 bits (63), Expect = 9.1 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = -1 Query: 253 PSVVLLASVCGLDRLRPSPWTPSWVLSRVSFCHLHGQTWLYAETLIKLL 107 P+V+ +A++ D L + W ++++ H+HG W+Y E L +L Sbjct: 109 PAVIYMANLALADLL-----SVIWFPLKIAY-HIHGNNWIYGEALCNVL 151 >U36753-1|AAA90957.1| 369|Homo sapiens protease-activated receptor 2 protein. Length = 369 Score = 29.5 bits (63), Expect = 9.1 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = -1 Query: 253 PSVVLLASVCGLDRLRPSPWTPSWVLSRVSFCHLHGQTWLYAETLIKLL 107 P+V+ +A++ D L + W ++++ H+HG W+Y E L +L Sbjct: 81 PAVIYMANLALADLL-----SVIWFPLKIAY-HIHGNNWIYGEALCNVL 123 >BT009856-1|AAP88858.1| 397|Homo sapiens coagulation factor II (thrombin) receptor-like 1 protein. Length = 397 Score = 29.5 bits (63), Expect = 9.1 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = -1 Query: 253 PSVVLLASVCGLDRLRPSPWTPSWVLSRVSFCHLHGQTWLYAETLIKLL 107 P+V+ +A++ D L + W ++++ H+HG W+Y E L +L Sbjct: 109 PAVIYMANLALADLL-----SVIWFPLKIAY-HIHGNNWIYGEALCNVL 151 >BC018130-1|AAH18130.1| 397|Homo sapiens coagulation factor II (thrombin) receptor-like 1 protein. Length = 397 Score = 29.5 bits (63), Expect = 9.1 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = -1 Query: 253 PSVVLLASVCGLDRLRPSPWTPSWVLSRVSFCHLHGQTWLYAETLIKLL 107 P+V+ +A++ D L + W ++++ H+HG W+Y E L +L Sbjct: 109 PAVIYMANLALADLL-----SVIWFPLKIAY-HIHGNNWIYGEALCNVL 151 >BC012453-1|AAH12453.1| 397|Homo sapiens coagulation factor II (thrombin) receptor-like 1 protein. Length = 397 Score = 29.5 bits (63), Expect = 9.1 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = -1 Query: 253 PSVVLLASVCGLDRLRPSPWTPSWVLSRVSFCHLHGQTWLYAETLIKLL 107 P+V+ +A++ D L + W ++++ H+HG W+Y E L +L Sbjct: 109 PAVIYMANLALADLL-----SVIWFPLKIAY-HIHGNNWIYGEALCNVL 151 >AY336105-1|AAP97012.1| 397|Homo sapiens protease-activated receptor 2 protein. Length = 397 Score = 29.5 bits (63), Expect = 9.1 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = -1 Query: 253 PSVVLLASVCGLDRLRPSPWTPSWVLSRVSFCHLHGQTWLYAETLIKLL 107 P+V+ +A++ D L + W ++++ H+HG W+Y E L +L Sbjct: 109 PAVIYMANLALADLL-----SVIWFPLKIAY-HIHGNNWIYGEALCNVL 151 >AF400075-1|AAK77914.1| 397|Homo sapiens coagulation factor II (thrombin) receptor-like 1 protein. Length = 397 Score = 29.5 bits (63), Expect = 9.1 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = -1 Query: 253 PSVVLLASVCGLDRLRPSPWTPSWVLSRVSFCHLHGQTWLYAETLIKLL 107 P+V+ +A++ D L + W ++++ H+HG W+Y E L +L Sbjct: 109 PAVIYMANLALADLL-----SVIWFPLKIAY-HIHGNNWIYGEALCNVL 151 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 67,104,615 Number of Sequences: 237096 Number of extensions: 1202214 Number of successful extensions: 2171 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2075 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2171 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 6098631048 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -