BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10e07 (547 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 29 0.031 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 24 0.88 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 23 2.7 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 22 4.7 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 22 4.7 AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. 21 6.2 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 29.1 bits (62), Expect = 0.031 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 137 SPTDPYHQSLFAKLENPDVVYQNFVKRLAKYHF 235 +PTD Y +S F L+NP V + F+ A F Sbjct: 540 TPTDSYIRSFFELLQNPKVSNEQFLNTAATLSF 572 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 24.2 bits (50), Expect = 0.88 Identities = 12/50 (24%), Positives = 25/50 (50%) Frame = +2 Query: 197 YQNFVKRLAKYHFQVKAIIQDILECRESMEKLNELNEKGRAKITEVREEL 346 ++ F + + H+QVKA+++ +++ + S + K E EEL Sbjct: 254 FEYFTRTIPSDHYQVKAMVEIVMKMKWSYVSIIYEESNYGIKAFEELEEL 303 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 22.6 bits (46), Expect = 2.7 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +3 Query: 462 IVCLLLKRHKEKI 500 I+C+ +KR KEKI Sbjct: 672 IICINIKRQKEKI 684 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.8 bits (44), Expect = 4.7 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 196 LSEFREEIG*VSFSSQSNYPGY 261 LS F ++IG ++ +Q N GY Sbjct: 209 LSYFTQDIGLAAYYAQVNLAGY 230 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 21.8 bits (44), Expect = 4.7 Identities = 9/22 (40%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = -1 Query: 175 FCK-QRLMIWVRWTQIHFEGHC 113 FC +R+++ R Q H E HC Sbjct: 226 FCAARRIVLEERRAQSHLEAHC 247 >AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. Length = 104 Score = 21.4 bits (43), Expect = 6.2 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = +3 Query: 117 WPSKWI*VQRTHIINRCL 170 W SKW+ + + RCL Sbjct: 69 WQSKWLSINHSACAIRCL 86 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,055 Number of Sequences: 438 Number of extensions: 2739 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15581757 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -