BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmte10e06 (637 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g35390.2 68415.m04339 ribose-phosphate pyrophosphokinase 1 / ... 84 6e-17 At2g35390.1 68415.m04338 ribose-phosphate pyrophosphokinase 1 / ... 84 6e-17 At2g44530.1 68415.m05539 ribose-phosphate pyrophosphokinase, put... 80 1e-15 At1g32380.1 68414.m03995 ribose-phosphate pyrophosphokinase 2 / ... 79 2e-15 At3g53760.1 68416.m05939 tubulin family protein similar to SP|Q9... 32 0.28 At5g27950.1 68418.m03366 kinesin motor protein-related kinesin h... 30 1.5 At5g13720.1 68418.m01597 expressed protein 28 4.5 At1g66730.1 68414.m07585 ATP dependent DNA ligase family protein... 28 6.0 At3g20240.1 68416.m02564 mitochondrial substrate carrier family ... 27 7.9 At1g51470.1 68414.m05793 glycosyl hydrolase family 1 protein con... 27 7.9 At1g47600.1 68414.m05285 glycosyl hydrolase family 1 protein con... 27 7.9 >At2g35390.2 68415.m04339 ribose-phosphate pyrophosphokinase 1 / phosphoribosyl diphosphate synthetase 1 (PRSI) identical to phosphoribosyl diphosphate synthetase 1 (ribose-phosphate pyrophosphokinase 1 (PRS I) [Arabidopsis thaliana] GI:633140, SP|Q42581 Length = 403 Score = 84.2 bits (199), Expect = 6e-17 Identities = 42/96 (43%), Positives = 65/96 (67%) Frame = +2 Query: 350 EINKEEKHFNNPSARMPNIKVFTGSSHPDIAKTIVARLGLNLGRATTKKFSNKETNVEIG 529 E + EK N + R+ K+F+G+++P +A+ I +GL+LG+ K+F++ E V++ Sbjct: 78 ESARMEKSVNRTNTRL---KLFSGTANPALAQEIAWYMGLDLGKVNIKRFADGEIYVQLQ 134 Query: 530 ESVRGEDVYIVQSGCGEINDNLMELFIMINACKIAS 637 ESVRG DVY+VQ C N+NLMEL IM++AC+ AS Sbjct: 135 ESVRGCDVYLVQPTCTPTNENLMELLIMVDACRRAS 170 >At2g35390.1 68415.m04338 ribose-phosphate pyrophosphokinase 1 / phosphoribosyl diphosphate synthetase 1 (PRSI) identical to phosphoribosyl diphosphate synthetase 1 (ribose-phosphate pyrophosphokinase 1 (PRS I) [Arabidopsis thaliana] GI:633140, SP|Q42581 Length = 352 Score = 84.2 bits (199), Expect = 6e-17 Identities = 42/96 (43%), Positives = 65/96 (67%) Frame = +2 Query: 350 EINKEEKHFNNPSARMPNIKVFTGSSHPDIAKTIVARLGLNLGRATTKKFSNKETNVEIG 529 E + EK N + R+ K+F+G+++P +A+ I +GL+LG+ K+F++ E V++ Sbjct: 27 ESARMEKSVNRTNTRL---KLFSGTANPALAQEIAWYMGLDLGKVNIKRFADGEIYVQLQ 83 Query: 530 ESVRGEDVYIVQSGCGEINDNLMELFIMINACKIAS 637 ESVRG DVY+VQ C N+NLMEL IM++AC+ AS Sbjct: 84 ESVRGCDVYLVQPTCTPTNENLMELLIMVDACRRAS 119 >At2g44530.1 68415.m05539 ribose-phosphate pyrophosphokinase, putative / phosphoribosyl diphosphate synthetase, putative very strong similarity to phosphoribosyl pyrophosphate synthase [Spinacia oleracea] GI:4902849; contains Pfam profile PF00156: Phosphoribosyl transferase domain Length = 394 Score = 80.2 bits (189), Expect = 1e-15 Identities = 36/78 (46%), Positives = 58/78 (74%) Frame = +2 Query: 404 IKVFTGSSHPDIAKTIVARLGLNLGRATTKKFSNKETNVEIGESVRGEDVYIVQSGCGEI 583 +++F+G+++P +A+ I LGL+LG+ K+F++ E V++ ESVRG DV++VQ C Sbjct: 78 LRIFSGTANPILAQEISCYLGLDLGKIKIKRFADGEIYVQLQESVRGCDVFLVQPTCPPA 137 Query: 584 NDNLMELFIMINACKIAS 637 N+NLMEL +MI+AC+ AS Sbjct: 138 NENLMELLVMIDACRRAS 155 >At1g32380.1 68414.m03995 ribose-phosphate pyrophosphokinase 2 / phosphoribosyl diphosphate synthetase 2 (PRS2) identical to SP:Q42583 from [Arabidopsis thaliana]; strong similarity to phosphoribosyl diphosphate synthetase 1 (ribose-phosphate pyrophosphokinase 1 (PRS I) [Arabidopsis thaliana] GI:633140, SP|Q42581 Length = 400 Score = 79.4 bits (187), Expect = 2e-15 Identities = 35/78 (44%), Positives = 58/78 (74%) Frame = +2 Query: 404 IKVFTGSSHPDIAKTIVARLGLNLGRATTKKFSNKETNVEIGESVRGEDVYIVQSGCGEI 583 +K+F+G+++P +++ I +GL LG+ + K+F++ E V++ ESVRG DV++VQ C Sbjct: 90 LKLFSGTANPALSQEIAWYMGLELGKVSIKRFADGEIYVQLKESVRGCDVFLVQPTCTPT 149 Query: 584 NDNLMELFIMINACKIAS 637 N+NLMEL IM++AC+ AS Sbjct: 150 NENLMELLIMVDACRRAS 167 >At3g53760.1 68416.m05939 tubulin family protein similar to SP|Q9SC88 Gamma-tubulin complex component 4 homolog {Medicago truncatula}, SP|Q9UGJ1|GCP4_HUMAN Gamma-tubulin complex component 4 {Homo sapiens}; contains Pfam profile PF04130: Spc97 / Spc98 family Length = 745 Score = 32.3 bits (70), Expect = 0.28 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = +2 Query: 329 FEEKQVKEINKEEKHFNNPSARMPNIKVFTGSSHPDIAKTIVARLG 466 F+ K I +E+K+F+ S RMP+ V SS D+ ++ V+ G Sbjct: 448 FQLAATKTIAEEDKYFSRVSLRMPSFGVTVRSSQADMVRSKVSLTG 493 >At5g27950.1 68418.m03366 kinesin motor protein-related kinesin heavy chain-like protein, potato, PIR:T07397 Length = 625 Score = 29.9 bits (64), Expect = 1.5 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = +1 Query: 373 LQQPKCQNAEHKSVYWKLSSRHRENYRRKARSKL 474 LQ+ +C EHK ++W + ++ E+ +KA S L Sbjct: 443 LQEVECLVNEHKKLFWITNDKYLEDIEKKAISPL 476 >At5g13720.1 68418.m01597 expressed protein Length = 262 Score = 28.3 bits (60), Expect = 4.5 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = -2 Query: 426 ELPVNTFMFGILALGLLKCFSSLLISFTCFSSNCIYIV 313 E V +F L LL SL S CF + C+YIV Sbjct: 80 ESNVERIIFDFRFLALLAVGGSLAGSLLCFLNGCVYIV 117 >At1g66730.1 68414.m07585 ATP dependent DNA ligase family protein contains Pfam profile: PF01068 ATP dependent DNA ligase domain Length = 1417 Score = 27.9 bits (59), Expect = 6.0 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +2 Query: 314 TI*MQFEEKQVKEINKEEKHFNNPSARMPNIKVF 415 T+ + E+ KE+NK +KHF+ M N K F Sbjct: 376 TVGVDIEKFDCKEVNKMQKHFSGLVDEMANKKDF 409 >At3g20240.1 68416.m02564 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier proteins Length = 348 Score = 27.5 bits (58), Expect = 7.9 Identities = 12/48 (25%), Positives = 24/48 (50%) Frame = -2 Query: 333 SNCIYIVYDEAVTSLVRSQLRVKLRYILIITINYLGSRRGHLVTYPLQ 190 S C Y +YD+ TS +S+ + L ++ + L +++PL+ Sbjct: 228 STCYYFMYDKMKTSYCKSKNKKALSRPEMLVLGALAGLTASTISFPLE 275 >At1g51470.1 68414.m05793 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to Myrosinase precursor (SP:P37702) [Arabidopsis thaliana]; similar to thioglucosidase (GI:871992) [Arabidopsis thaliana] Length = 511 Score = 27.5 bits (58), Expect = 7.9 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -1 Query: 619 VYHYEKFHQVIVYFPTAALNNVDILTSNGFADFNVG 512 VY+ F Q++ Y N + +T NG AD ++G Sbjct: 392 VYYPPGFRQILNYIKDNYKNPLTYITENGVADLDLG 427 >At1g47600.1 68414.m05285 glycosyl hydrolase family 1 protein contains Pfam PF00232 : Glycosyl hydrolase family 1 domain; TIGRFAM TIGR01233: 6-phospho-beta-galactosidase; similar to thioglucosidase (GI:871992) [Arabidopsis thaliana] Length = 511 Score = 27.5 bits (58), Expect = 7.9 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -1 Query: 619 VYHYEKFHQVIVYFPTAALNNVDILTSNGFADFNVG 512 VY+ F Q++ Y N + +T NG AD ++G Sbjct: 392 VYYPPGFRQILNYIKDNYKNPLTYITENGVADLDLG 427 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,757,175 Number of Sequences: 28952 Number of extensions: 215436 Number of successful extensions: 594 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 586 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 594 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1305036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -